KEGG   Blastococcus saxobsidens: BLASA_2369Help
Entry
BLASA_2369        CDS       T01752                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bsd  Blastococcus saxobsidens
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bsd00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2277112..2277711
Genome map
AA seq 199 aa AA seqDB search
MAAATSARLTVLSGPSGVGKGTVVAAVRQRHPDVWVSVSVTTRRPRVGEVDGVHYHFVED
AEFDRLIATDGLLEWAEYAGNRYGTPVAPVAAQLATGRPALLEIELQGARQVRARAQEAQ
LVFLAPPSWGELVSRLAGRGSEPAAVQERRLAIAQAELVSSGEFDVVVVNDDVARAADEL
VGLLTAPSPSLCPGGSAHE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcagcgacatcggcacggctgaccgtgctctccggaccctccggggtgggcaag
ggcaccgtggtcgccgcggtccggcagcggcaccccgatgtgtgggtgtcggtgtcggtg
accactcgtcgtcctcgcgtcggtgaggtcgacggcgtccactaccacttcgtcgaggac
gccgagttcgatcgcctgatcgccaccgacgggctgctggagtgggccgagtacgccggc
aaccgctacggcaccccggtcgctcccgtggcggcgcagctggccaccggccggccggcg
ctgctggagatcgagctgcagggcgcccggcaggtgcgggcccgggcacaggaggcgcag
ctggtcttcctcgccccgccttcctggggggaactggtcagccggctggccggccgcggg
tcggagccggcggccgtccaggagcgccggctggccatcgcgcaggccgagctcgtctcg
tccggggagttcgacgtggtcgtcgtcaacgacgacgtggcccgcgctgcggacgagttg
gtaggcttgctgactgcgccgtcacccagcctctgtccgggcggcagcgcccacgagtga

DBGET integrated database retrieval system