KEGG   Blastococcus saxobsidens: BLASA_2396Help
Entry
BLASA_2396        CDS       T01752                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00500  Starch and sucrose metabolism
bsd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLASA_2396
Enzymes [BR:bsd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BLASA_2396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CCG03299
UniProt: H6RVM4
Position
complement(2301695..2303524)
Genome map
AA seq 609 aa AA seqDB search
MNAKPTTDDWGIDASWIDALDAEHQVAQTTIDTLRAVIGEPPADLDDRAPIVARPGDALE
VDEADVVCEDGEVRHIDGELPAGFPLGYHWLQSPEGRRRRLIVSPGRCWLPEDRAWGWTV
QLYAARGRDSWGIGDLGDLRTIRRMAADQGAGFVLINPLHAVAPIQEQEASPYLPATRRF
QNPIYLRVSEVPGADAVDLEEDAGRALSDGPLIDRDAIWARKREVLMRIFFAHGGGEAFV
RWREAQGQTLQDWATWAAITEAHGADWHTWPAELRRPDGPGVTTYAEQHGAVVAFHAWLQ
WALELQFTAATDGMTVIQDLPIGFAGGGADAWAWQEVLADGVSVGAPPDAFNSAGQDWGS
PPLIPWRLRDADYEPFIQSIRATMAGAGGLRIDHVMGLFRLWWVPADSGAADGAYVRYPA
EDLLNIVALESHRAQALVVGEDLGTVEEGVREAMAEHGVLSYRLLWFEDDEPSEWPAEAM
AAITTHDLPTVAGLWTEADVDEQREHGTGTDDELERGRTSLLEHLPGLSDDATVEQAVEE
AHALLATAPSLLLSATLDDAVGEQRRPNMPGAGDRPNWSLPLPVLVEDLPAHPLLETVAR
TLTEGLDSD
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgcgaagccgaccaccgacgactggggcatcgatgcgagctggatcgatgcgctc
gacgcggagcaccaggtagcccagacgaccatcgacacgctgcgggcggtcatcggggag
ccacccgcggatctggacgaccgggcgcccatcgtcgcccggcccggcgacgcgctggag
gtcgacgaggccgacgtcgtctgcgaggacggcgaggtgcggcacatcgacggcgagctg
cccgcgggcttcccgctcggctaccactggctgcagtcgcccgagggccggcggcggcgg
ctgatcgtctcgccgggccgctgctggctgcccgaggaccgcgcgtggggctggaccgtg
cagctctacgccgcccgtggccgggacagctggggcatcggcgatctcggcgatctccgg
accatccggcggatggccgccgaccagggcgccgggttcgtgctgatcaacccgttgcac
gccgtcgcaccgatccaggagcaggaggcgagcccctacctgccggccacccgccggttc
cagaacccgatctacctgcgggtgagcgaggtacccggtgccgacgccgtggacctggag
gaggacgccggccgcgcgctctccgacgggccgctgatcgaccgggacgcgatctgggcc
cgcaagcgcgaagtgctcatgcggatcttcttcgcccacggcggtggggaggcgttcgtg
cgctggcgcgaggcgcaggggcagacgctgcaggactgggcgacctgggccgcgatcacc
gaggcgcacggcgccgactggcacacctggccggccgagctgcgccggcccgacggcccc
ggcgtcaccacctatgccgagcagcacggcgctgtcgtcgcgttccacgcctggctgcag
tgggcgctggagctgcagttcaccgccgccaccgacggcatgaccgtcatccaggacctg
ccgatcggcttcgccggcggcggcgccgacgcctgggcgtggcaggaggtgctggccgac
ggcgtgagcgtcggcgcaccgccggacgcgttcaactcggccggtcaggactgggggtcc
ccgccgctgatcccgtggcggctgcgcgacgcggactacgagccgttcatccagtccatc
cgcgccaccatggccggcgccggcgggctgcggatcgaccacgtcatgggcctgttccgg
ctgtggtgggtgcccgccgacagcggcgccgccgacggtgcctacgtccgctatcccgcc
gaggacctgctgaacatcgtcgccctggagagccaccgggcgcaggccctggtggtcggg
gaggacctcggcaccgtcgaggagggggtccgcgaggcgatggccgagcacggggtgctc
tcctaccggctgctgtggttcgaggacgacgagccctcggagtggccggccgaggcgatg
gccgcgatcaccacccacgacctgccgaccgtggccgggctgtggaccgaggccgacgtc
gacgagcagcgcgagcacggcacgggcaccgacgacgagctcgagcggggccgcacctca
ctgctggagcacctcccggggctctccgacgacgcgacggtggagcaggcggtggaggag
gcgcatgcgctgctggcgaccgcgccgtccctgttgctgtcggccacgctcgacgacgcg
gtcggcgagcaacggcggcccaacatgcccggcgccggcgaccgacccaactggtcgctg
ccgctgcccgtgctggtcgaggacctgccggcgcacccgctgctggagacggtggcccgc
accctgacggaaggcctggacagcgactga

DBGET integrated database retrieval system