KEGG   Blastococcus saxobsidens: BLASA_2426Help
Entry
BLASA_2426        CDS       T01752                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsd  Blastococcus saxobsidens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bsd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2329697..2330737)
Genome map
AA seq 346 aa AA seqDB search
MSDTGEEPAIDLPLAGYTVAVTAARRKEELGALLDRRGARVVYAPAIRIVPLADDSELLA
ATGRVLTAPVDLVVATTAVGFRGWLEAADAWDLPLVQHLSGSRVLARGPKARGAVRSAGL
VDAWSPESESSAGVLEHLLSGTEGPLEGRRVAVQLHGDPLRELVAGLRDAGAEVLPVPVY
RWLPPEDVAPLHRLVGMVVAGEVDAVTFTSAPAAASLLRTAEDLGQRAALVAAFDGRVLA
VAVGTVTGGPLEAAGIPYAHPERGRLGPLAVRSSRGCPAGTRCCGSVRTPSRCAATPPSS
TGTWWNSPPDRWPCCASWPGSPAGSSPGPTSAPRGPAATATSSIRR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacaccggcgaggaaccggcgatcgacctgccgctggcgggctacacagtcgcg
gtgacggccgcccggcgcaaggaggagctgggggcgctcctcgaccgccgcggcgcccgt
gtggtctacgcgccggcgatccgcatcgtgccgctggccgacgactccgagctgctcgcg
gccaccggtcgggtgctcaccgccccggtcgacctcgtcgtcgccaccaccgctgtcggc
ttccggggctggctcgaggccgccgacgcctgggacctgcccctcgtgcagcacctgtcg
gggtcccgtgtgctcgcccgcggcccgaaagcgcgcggcgccgtccggagcgccggtctc
gtcgacgcctggtcgccggagtcggagtcctccgccggggtgctggaacacctgctgtcc
gggaccgagggccccctggaggggcggcgcgtcgccgtccagttgcacggcgacccgctg
cgcgagctcgtggccggcctgcgggacgccggcgcggaggtgctgccggtgccggtctac
cgctggctgccgcccgaggacgtcgccccgctgcaccgcctcgtcgggatggtcgtcgcc
ggcgaggtcgacgcggtgaccttcaccagcgccccggccgccgcgagcctcctccggacg
gccgaggacctggggcagcgggcggccctcgtcgccgcgttcgacggccgggtgctcgcg
gtcgccgtcggcacggtcaccggcggcccgctcgaggcggccggcatcccctacgcccac
ccggagcgggggcggctggggccgctcgccgtgaggtcgtcgcgcggctgtccggccggg
acccggtgctgcggatcggtgcgcacaccctccaggtgcgcggccacgccgccgtcgtcg
acgggcacctggtggaactcgcccccggaccgctggccgtgctgcgcgagctggcccggc
agcccggccgggtcatcgccgggcccgacctcggcaccgcgcggcccggcggcgacggcc
acgagctcgattcgacggtga

DBGET integrated database retrieval system