KEGG   Blastococcus saxobsidens: BLASA_2646Help
Entry
BLASA_2646        CDS       T01752                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bsd  Blastococcus saxobsidens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLASA_2646 (tdk)
Enzymes [BR:bsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BLASA_2646 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2528140..2528895
Genome map
AA seq 251 aa AA seqDB search
MTAVESGSPTTPQPLSFPAAVPASGDRRRHPAPAHLRFFHGPMDCGKSTLALQVDHNHSR
QGRHGLLVTQGDRSAAPQISSRVGLCRDAIDIDGGTDLRLLVRDRWADGHRVDYLIVDEA
QFLSPGQVDQLAELVDESHVDVYAFGLTTDFRTRLFPGTQRLLEVADDVQRIQVEVLCWC
GLPGLLNARVVDGVMVRSGKTVVVADTAPAELPGKAPGPSPAVRYQVLCRRHYARGELGP
TAAGPGQLALP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcggtcgaatcagggtccccgaccactcctcagccgctgtcgttcccggccgcg
gtgccggcgtccggggaccggcgccggcaccccgctccggcgcacctgcggttcttccac
gggccgatggactgcgggaagtcgacgctggcgctgcaggtggaccacaaccacagccgg
cagggtcggcacggcctgctggtcacccagggcgaccgctccgccgcgccgcagatcagc
tcccgcgtcgggctgtgccgcgacgccatcgacatcgacgggggtaccgatctgcggctg
ctcgtccgggaccggtgggcggacggccaccgggtggactacctgatcgtcgacgaggcg
cagttcctctcccccggccaggtggaccagctcgccgagctcgtggacgagtcgcacgtc
gacgtctacgcgttcgggctgacgaccgacttccgcacccggctgttcccgggcacccag
cggctgctggaggtggccgacgacgtccagcgcatccaggtcgaggtgctgtgctggtgc
ggcctgcccgggctgctcaacgcccgcgtcgtcgacggcgtcatggtgcgctcggggaag
accgtcgtcgtcgccgacaccgcccctgccgaactgcccgggaaagcccccggcccctcc
cccgccgtccggtaccaggtgctgtgccgacggcactatgcgcggggtgaactggggccc
acggcggccgggccagggcagctggccctgccctga

DBGET integrated database retrieval system