KEGG   Blastococcus saxobsidens: BLASA_2702Help
Entry
BLASA_2702        CDS       T01752                                 

Definition
putative ATP-dependent exoDNAse (Exonuclease V), alpha subunit/helicase superfamily I member
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsd  Blastococcus saxobsidens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bsd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2583647..2585596
Genome map
AA seq 649 aa AA seqDB search
MGEPPTPGPDLIFAAFCTAGLWPGLGKRTAAELPAAGITTPDDVSADRLVKLPRVGRQRA
ERLFSSFLAAAPTYEVVEMLVAAGLPAKLASGVADGLGPDAARRLRDDPWGLLGLPGVTL
ADADRLAIAVLKGADRQDTRRGRAIVALTLRTATRDGHTVLPLDLVVAALQAERIADPVA
AVVAAVDSGEVLEHEPPEPEFDEDAEEPPEPDPALRTLSLARFGMAEEAVAENVARLAAA
AEQIADPASVRTVAQGLDEAQKKAVAQVLTAGVSLLTGGPGTGKSRTVAAVVKLLKAKGT
DVALAAPTGRAAKRLEELTDHPAGTVHRLLGAQGASGGFARGEEWPLDADVVVVDEASML
DVELAAALLEACPDGTHLLLVGDPAQLPSIGPGHVLGDLIDSGIVPVTELTTLYRQAEGG
AIARLASAVRSGELPPVDSPDREVVVVPATGSAEAARRVVQLVTDSIPRALGIEPGAVQV
VTPVHRGPAGTIELNKALKAQLNPGEGAVFGFDPGDRVVATANHLDLEPTGFANGEVGVV
TKTGDGSMDVAFASGPVTVSGQALFDLRHGWAITVHRAQGSEWPGVVVVLPPEAGGMLSR
PLVYTALTRAQRHLSIVHASGAALARAVRDVDVRPRRTRLAELLREIAG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaacctcccacccccgggccggacctgatcttcgcggcgttctgcaccgcgggt
ctgtggcccggtctcggcaagcgcaccgccgcggagctgccggccgccggcatcaccacg
ccggacgacgtctcggccgaccggctcgtgaagctgcccagggtcggccggcagcgggcc
gagcggctgttctcgagcttcctcgccgccgcccccacctacgaggtggtggagatgctg
gtggcggccgggctgccggccaagctcgcctccggggtcgccgacgggctggggcccgac
gccgcccgccggctgcgggacgacccgtgggggctgctggggctgcccggggtgaccctg
gccgacgccgaccggttggccatcgccgtcctcaagggcgccgaccggcaggacacccgg
cgcggccgcgcgatcgtggcgctcaccctgcgcaccgcgacccgcgacgggcacaccgtc
ctcccgctcgacctcgtcgtcgccgcgctgcaggccgagcggatcgcggatccggtggcc
gccgtggtggccgccgtcgactccggggaggtgctcgagcacgagccgccggagccggag
ttcgacgaggacgcggaggaaccgcctgaacctgatccggcgctgcgcacgctgtcgctg
gccaggttcggcatggccgaggaggccgtggccgagaacgtggcccggctggccgccgcg
gccgagcagatcgccgaccccgcctcggtgcgcacggtggcccagggcctggacgaggcg
cagaagaaggccgtggcccaggtgctgacggcgggggtcagcctgctcaccggcggcccc
ggcaccggcaagagccgcaccgtggctgcggtggtgaagctgctgaaggccaagggcacc
gacgtggcgctggcggcgcccaccgggcgggcggccaagcggctggaggaactcaccgac
cacccggcgggaacggtgcaccggctgctgggcgcccagggcgcctcgggcggcttcgcc
cgcggcgaggagtggccgctggacgccgacgtggtggtggtcgacgaggcctcgatgctc
gacgtcgagctggccgcggcgctgctggaggcctgccccgacggcacgcacctgctgctg
gtgggcgacccggcgcagctgccctcgatcgggcccgggcacgtgctcggcgacctgatc
gactccggcatcgtcccggtgaccgagctgaccaccctgtaccggcaggccgagggcggt
gcgatcgcccggctggcctcggcggtgcgcagcggtgagctgccgccggtcgactccccc
gaccgagaggtggtcgtggtgccggccaccggcagcgccgaggccgcccgccgggtggtg
cagctggtcaccgactccatcccccgcgcgctgggtatcgagccgggtgcggtgcaggtg
gtcaccccggtgcaccgcgggccggccgggaccatcgagctcaacaaggcgctgaaggcg
cagctgaacccgggcgagggcgcggtgttcggcttcgacccgggcgaccgggtggtagcc
accgccaaccacctcgatctggagccgaccggcttcgccaacggcgaggtcggcgtggtc
accaagaccggcgacgggtcgatggacgtggcattcgcctccgggccggtcacggtcagc
gggcaggcgctgttcgacctgcggcacggctgggcgatcaccgtgcaccgggcgcaaggc
tcggagtggcccggagtcgtggtggtgctgccgccggaggccggcgggatgctctcccgg
ccgctggtctacacggcgctcacccgggcacagcggcacctgtcgatcgtgcacgccagt
ggcgccgcgctggcccgggcggtacgcgacgtcgacgtccggccgcgccgcacccggctg
gccgagctgctgcgcgagattgcgggctga

DBGET integrated database retrieval system