KEGG   Blastococcus saxobsidens: BLASA_2702Help
Entry
BLASA_2702        CDS       T01752                                 

Definition
putative ATP-dependent exoDNAse (Exonuclease V), alpha subunit/helicase superfamily I member
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bsd  Blastococcus saxobsidens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BLASA_2702
Enzymes [BR:bsd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BLASA_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2583647..2585596
Genome map
AA seq 649 aa AA seqDB search
MGEPPTPGPDLIFAAFCTAGLWPGLGKRTAAELPAAGITTPDDVSADRLVKLPRVGRQRA
ERLFSSFLAAAPTYEVVEMLVAAGLPAKLASGVADGLGPDAARRLRDDPWGLLGLPGVTL
ADADRLAIAVLKGADRQDTRRGRAIVALTLRTATRDGHTVLPLDLVVAALQAERIADPVA
AVVAAVDSGEVLEHEPPEPEFDEDAEEPPEPDPALRTLSLARFGMAEEAVAENVARLAAA
AEQIADPASVRTVAQGLDEAQKKAVAQVLTAGVSLLTGGPGTGKSRTVAAVVKLLKAKGT
DVALAAPTGRAAKRLEELTDHPAGTVHRLLGAQGASGGFARGEEWPLDADVVVVDEASML
DVELAAALLEACPDGTHLLLVGDPAQLPSIGPGHVLGDLIDSGIVPVTELTTLYRQAEGG
AIARLASAVRSGELPPVDSPDREVVVVPATGSAEAARRVVQLVTDSIPRALGIEPGAVQV
VTPVHRGPAGTIELNKALKAQLNPGEGAVFGFDPGDRVVATANHLDLEPTGFANGEVGVV
TKTGDGSMDVAFASGPVTVSGQALFDLRHGWAITVHRAQGSEWPGVVVVLPPEAGGMLSR
PLVYTALTRAQRHLSIVHASGAALARAVRDVDVRPRRTRLAELLREIAG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaacctcccacccccgggccggacctgatcttcgcggcgttctgcaccgcgggt
ctgtggcccggtctcggcaagcgcaccgccgcggagctgccggccgccggcatcaccacg
ccggacgacgtctcggccgaccggctcgtgaagctgcccagggtcggccggcagcgggcc
gagcggctgttctcgagcttcctcgccgccgcccccacctacgaggtggtggagatgctg
gtggcggccgggctgccggccaagctcgcctccggggtcgccgacgggctggggcccgac
gccgcccgccggctgcgggacgacccgtgggggctgctggggctgcccggggtgaccctg
gccgacgccgaccggttggccatcgccgtcctcaagggcgccgaccggcaggacacccgg
cgcggccgcgcgatcgtggcgctcaccctgcgcaccgcgacccgcgacgggcacaccgtc
ctcccgctcgacctcgtcgtcgccgcgctgcaggccgagcggatcgcggatccggtggcc
gccgtggtggccgccgtcgactccggggaggtgctcgagcacgagccgccggagccggag
ttcgacgaggacgcggaggaaccgcctgaacctgatccggcgctgcgcacgctgtcgctg
gccaggttcggcatggccgaggaggccgtggccgagaacgtggcccggctggccgccgcg
gccgagcagatcgccgaccccgcctcggtgcgcacggtggcccagggcctggacgaggcg
cagaagaaggccgtggcccaggtgctgacggcgggggtcagcctgctcaccggcggcccc
ggcaccggcaagagccgcaccgtggctgcggtggtgaagctgctgaaggccaagggcacc
gacgtggcgctggcggcgcccaccgggcgggcggccaagcggctggaggaactcaccgac
cacccggcgggaacggtgcaccggctgctgggcgcccagggcgcctcgggcggcttcgcc
cgcggcgaggagtggccgctggacgccgacgtggtggtggtcgacgaggcctcgatgctc
gacgtcgagctggccgcggcgctgctggaggcctgccccgacggcacgcacctgctgctg
gtgggcgacccggcgcagctgccctcgatcgggcccgggcacgtgctcggcgacctgatc
gactccggcatcgtcccggtgaccgagctgaccaccctgtaccggcaggccgagggcggt
gcgatcgcccggctggcctcggcggtgcgcagcggtgagctgccgccggtcgactccccc
gaccgagaggtggtcgtggtgccggccaccggcagcgccgaggccgcccgccgggtggtg
cagctggtcaccgactccatcccccgcgcgctgggtatcgagccgggtgcggtgcaggtg
gtcaccccggtgcaccgcgggccggccgggaccatcgagctcaacaaggcgctgaaggcg
cagctgaacccgggcgagggcgcggtgttcggcttcgacccgggcgaccgggtggtagcc
accgccaaccacctcgatctggagccgaccggcttcgccaacggcgaggtcggcgtggtc
accaagaccggcgacgggtcgatggacgtggcattcgcctccgggccggtcacggtcagc
gggcaggcgctgttcgacctgcggcacggctgggcgatcaccgtgcaccgggcgcaaggc
tcggagtggcccggagtcgtggtggtgctgccgccggaggccggcgggatgctctcccgg
ccgctggtctacacggcgctcacccgggcacagcggcacctgtcgatcgtgcacgccagt
ggcgccgcgctggcccgggcggtacgcgacgtcgacgtccggccgcgccgcacccggctg
gccgagctgctgcgcgagattgcgggctga

DBGET integrated database retrieval system