KEGG   Blastococcus saxobsidens: BLASA_2827Help
Entry
BLASA_2827        CDS       T01752                                 

Gene name
pfkA2
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLASA_2827 (pfkA2)
   01230 Biosynthesis of amino acids
    BLASA_2827 (pfkA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLASA_2827 (pfkA2)
   00030 Pentose phosphate pathway
    BLASA_2827 (pfkA2)
   00051 Fructose and mannose metabolism
    BLASA_2827 (pfkA2)
   00052 Galactose metabolism
    BLASA_2827 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    BLASA_2827 (pfkA2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BLASA_2827 (pfkA2)
Enzymes [BR:bsd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BLASA_2827 (pfkA2)
Protein phosphatases and associated proteins [BR:bsd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BLASA_2827 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2704034..2705062)
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRSVVRTAGVHYGSEVIGFRDGWRGLLENRSTPLDVAAVDGL
LTRGGTTLGSARVAPEKLHAGIDEMRATLDQHGIDVLIPIGGEGTLTAAHVLSEAGVPVV
GIPKTIDNDIDGTDLTFGFDTAVSIATELIDRLHTTAESHQRVLLVEVMGRHAGWIALHA
GLAAGAHLTLVPEEPFDVDEVVRLVCERFARGDSHVIGVVAEGAMPLPGTMAFREGGIDE
FGHRRFSGVAQQLGEELERRTGKEVRATVLGHVQRGGTPTSFDRVLATRFGLHATTAAHE
GHHGQMVALRGTEIELVPLARAVARLKTVTPARLAETRAFTG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcggagtcctgaccggaggcggcgactgccccggcctcaacgcggtcatcaga
tcggtggtccgcactgcgggcgtccactacggcagcgaggtcatcggcttccgcgacggc
tggcgggggctgctggagaaccggtccacgcccctggacgtcgccgccgtcgacggactg
ctgacccgcggggggacgacgctgggctcggcccgcgtcgctccggagaagctgcacgcc
ggcatcgacgagatgcgggcgaccctcgaccagcacgggatcgacgtgctgatcccgatc
ggcggggagggcaccctcaccgcggcgcacgtgctgtccgaggccggcgtcccggtggtg
ggcatcccgaagaccatcgacaacgacatcgacggcaccgacctgaccttcgggttcgac
accgcggtcagcatcgccaccgagctcatcgaccggctgcacaccactgcggagtcccac
cagcgggtgctgctggtggaggtgatgggccggcacgccgggtggatcgcgctgcacgcc
ggtctcgccgccggcgcgcacctgaccctggtgcccgaggagccgttcgacgtcgacgag
gtggtccggctggtctgcgagcggttcgcgcgcggcgactcgcacgtcatcggcgtcgtc
gccgagggcgcgatgccgctgccggggacgatggcgttccgggagggcggcatcgacgag
ttcggccaccgccggttctccggcgtggcccagcagctgggcgaggagctggagcggcgc
accggcaaggaggtgcgggcgacggtgctcgggcacgtccagcgcggcgggacgccgacc
tcgttcgaccgggtcctggccacccgcttcggcctgcacgccaccaccgccgcgcacgag
gggcaccacggccagatggtcgccctgcgcggcacggagatcgagctggtcccgctggcc
cgcgccgtcgcccggctcaagaccgtgactcccgcccggctcgcggagacccgcgccttc
accggctga

DBGET integrated database retrieval system