KEGG   Blastococcus saxobsidens: BLASA_3031Help
Entry
BLASA_3031        CDS       T01752                                 

Gene name
caiD
Definition
carnitinyl-CoA dehydratase (EC:4.2.1.-)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bsd  Blastococcus saxobsidens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BLASA_3031 (caiD)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BLASA_3031 (caiD)
   00650 Butanoate metabolism
    BLASA_3031 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    BLASA_3031 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BLASA_3031 (caiD)
   00310 Lysine degradation
    BLASA_3031 (caiD)
   00360 Phenylalanine metabolism
    BLASA_3031 (caiD)
   00380 Tryptophan metabolism
    BLASA_3031 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BLASA_3031 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BLASA_3031 (caiD)
   00281 Geraniol degradation
    BLASA_3031 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BLASA_3031 (caiD)
   00627 Aminobenzoate degradation
    BLASA_3031 (caiD)
   00930 Caprolactam degradation
    BLASA_3031 (caiD)
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BLASA_3031 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2901759..2902526)
Genome map
AA seq 255 aa AA seqDB search
MDERKVLVERRGAVQVITINRPSARNALDAEVATAVAAAVDELDADDQLRAGVLTGSGGT
FSAGMDLKAFLRGESPSLPGRGLCGITRTPPRKPLIAAVEGWALAGGFELVLACDLVVAG
RTARFGVPEVKRSLVAAGGAALLLPQRVPRAVALELLLTGEPIGAERAAAAGLVNRLVDE
GDAVDAAVELAGTIAANGPLAVAATKRIVQEAPGWAPEEAWARHDEVTAPVFTSEDAREG
STAFAERREPVWRGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcgcaaggtcctggtggagcgccgcggcgccgtccaggtgatcaccatcaac
cggccgtcggcccgcaacgccctcgacgccgaggtggccacggcggtcgccgccgcggtc
gacgagctcgacgccgacgaccagctgcgggccggcgtgctcaccggctccgggggcacc
ttctcggccgggatggacctcaaggcgttcctgcgcggggagagcccgtcgctgcccggc
cgcgggctgtgcgggatcacccgcacgccgccacgcaagccgctgatcgccgccgtcgag
ggctgggcgctggccggcggcttcgagctggtcctcgcctgcgacctggtcgtcgccggc
cggacggcgcggttcggcgtcccggaggtcaagcggtcgctggtggccgccggaggtgcc
gcgctgctcctgccgcagcgcgtcccgcgcgccgtggcgctggagctgctgctgaccggg
gagccgatcggcgcggagcgggccgccgccgccgggctggtgaaccggctggtggacgag
ggagacgccgtcgacgcagccgtggagctcgccgggacgatcgccgccaacggcccgctc
gcggtggccgcgaccaagcggatcgtccaggaggcgccgggctgggcacccgaggaggca
tgggcacggcacgacgaggtgaccgcgccggtgttcacgtccgaggacgcccgcgagggc
tcgaccgcgttcgccgagcggcgggagccggtctggcgcggtcgctga

DBGET integrated database retrieval system