KEGG   Blastococcus saxobsidens: BLASA_3236Help
Entry
BLASA_3236        CDS       T01752                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLASA_3236 (tpiA)
   01230 Biosynthesis of amino acids
    BLASA_3236 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLASA_3236 (tpiA)
   00051 Fructose and mannose metabolism
    BLASA_3236 (tpiA)
   00562 Inositol phosphate metabolism
    BLASA_3236 (tpiA)
Enzymes [BR:bsd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BLASA_3236 (tpiA)
Exosome [BR:bsd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BLASA_3236 (tpiA)
  Exosomal proteins of bladder cancer cells
   BLASA_3236 (tpiA)
  Exosomal proteins of melanoma cells
   BLASA_3236 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3107097..3107903)
Genome map
AA seq 268 aa AA seqDB search
MIAGNWKMHMTHLEAIGLVQKVVFSLKENELDTAEVVVLPPFTALRSVQTLVTGDKLGIG
YGAQDLAAADSGAYTGEVSGGMLSALGCSYVAVGHSERRALHGEDDAVVAAKVNAALRHG
IVPILCVGEGLDVRRAGTHVAHCTGQLDAALEGLTAEQLTAPGDGTGIGAGPGGGLVIAY
EPVWAIGTGEVATPEDAQEVCGALRARLAERFGTETAQSVRILYGGSVKAANTAGILAGA
DIDGALVGGASLDADEFAQICRIAAGGS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgccggcaactggaagatgcacatgacccacctggaggccatcggcctggtccag
aaggtggtgttctcgctcaaggagaatgagctcgacaccgccgaggtcgtcgtcctcccg
ccgttcacggcgctgcgcagcgtgcagacgctggtcaccggcgacaagctgggcatcggg
tacggcgcgcaggacctcgcagcagcggactccggcgcgtacaccggtgaggtcagcggc
gggatgctcagcgctctgggctgcagctacgtcgcggtcgggcactcggagcgccgggcg
ctgcacggggaggacgacgccgtcgtcgcggccaaggtgaacgcggcgctgcgccacggc
atcgtgccgatcctctgcgtcggggaggggctcgacgtccgccgggcgggcacgcacgtc
gcgcactgcaccggtcagctggacgccgcgctcgaggggctgaccgccgagcagctgacc
gcgccgggggacggcaccgggatcggtgctgggccgggtggcgggctcgtcatcgcctac
gagccggtgtgggcgatcggcaccggcgaggtggccacccccgaggacgcgcaggaggtc
tgcggtgctctgcgggcgcggctcgccgagcgcttcggcaccgagacggctcagtccgtc
cgtatcctctacggcgggtcggtgaaggccgccaacacggccgggatcctggccggggcg
gacatcgacggtgcgctcgtcggtggtgccagcctggacgccgacgagttcgcccagatc
tgtcggatcgccgccggcggtagctga

DBGET integrated database retrieval system