KEGG   Blastococcus saxobsidens: BLASA_3568Help
Entry
BLASA_3568        CDS       T01752                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00071  Fatty acid degradation
bsd00280  Valine, leucine and isoleucine degradation
bsd00281  Geraniol degradation
bsd00310  Lysine degradation
bsd00360  Phenylalanine metabolism
bsd00362  Benzoate degradation
bsd00380  Tryptophan metabolism
bsd00410  beta-Alanine metabolism
bsd00627  Aminobenzoate degradation
bsd00640  Propanoate metabolism
bsd00650  Butanoate metabolism
bsd00903  Limonene and pinene degradation
bsd00930  Caprolactam degradation
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01120  Microbial metabolism in diverse environments
bsd01130  Biosynthesis of antibiotics
bsd01212  Fatty acid metabolism
Module
bsd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BLASA_3568
   00650 Butanoate metabolism
    BLASA_3568
  Lipid metabolism
   00071 Fatty acid degradation
    BLASA_3568
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BLASA_3568
   00310 Lysine degradation
    BLASA_3568
   00360 Phenylalanine metabolism
    BLASA_3568
   00380 Tryptophan metabolism
    BLASA_3568
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BLASA_3568
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BLASA_3568
   00281 Geraniol degradation
    BLASA_3568
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BLASA_3568
   00627 Aminobenzoate degradation
    BLASA_3568
   00930 Caprolactam degradation
    BLASA_3568
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BLASA_3568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 EGL-1
Motif
Other DBs
NCBI-ProteinID: CCG04430
UniProt: H6RU20
Position
complement(3439808..3440545)
Genome map
AA seq 245 aa AA seqDB search
MGQVHLEKQGGIAVLTVDNVEVKNGLTPEMGMQLSELCDDVDSDPAIGAAVVLGKGGTFC
SGADRRRWTAGSDQAEDKTYKELGAVYQAFRRVGTLQVPTIAAVRGAAVGAGINLALATD
LRIVSETARLMAGFLRIGLHPGGGYFTISSRTAGREATAAMGLFGEEIDGVRAAEIGLAW
KAVPDDQVEEFALELAGRAAKDPELAREATRSFRTEAGPPGIGWEAALHFERATQMWSQR
RRETA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgggacaggtacacctggagaagcagggcggcatcgccgtcctcaccgtcgacaacgtc
gaggtgaagaacgggctgacgcccgagatggggatgcagctgtcggagctctgcgacgac
gtcgacagcgacccggccatcggtgccgccgtcgtcctgggcaagggcggcacgttctgc
tccggtgccgatcgccggcgctggacggcgggctccgatcaggccgaggacaagacctac
aaggagctcggggcggtctaccaggcgttccgccgggtcgggacgctgcaggtgccgacg
atcgccgccgtccgcggtgccgccgtcggcgccggcatcaacctggcgctcgcgaccgac
ctgcggatcgtctcggagactgcgcggctgatggccggcttcctccgcatcggcctgcac
cccggcggcggctacttcacgatcagctcccggacggccggccgcgaggccaccgccgcg
atggggctgttcggcgaggagatcgacggtgtccgcgccgccgagatcggcctggcctgg
aaggccgtgcccgacgaccaggtcgaggagttcgcgctggagctcgccgggcgcgcggcc
aaggacccggagctggcccgcgaggccacccgctccttccgcaccgaggccggcccgccc
gggatcggctgggaggccgcactgcacttcgagcgggccacccagatgtggtcccagcgg
cggcgcgagaccgcctga

DBGET integrated database retrieval system