KEGG   Blastococcus saxobsidens: BLASA_3935Help
Entry
BLASA_3935        CDS       T01752                                 

Gene name
thrC2
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00260  Glycine, serine and threonine metabolism
bsd00750  Vitamin B6 metabolism
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01120  Microbial metabolism in diverse environments
bsd01230  Biosynthesis of amino acids
Module
bsd_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLASA_3935 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLASA_3935 (thrC2)
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLASA_3935 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCG04766
UniProt: H6RJ21
Position
complement(3802985..3804070)
Genome map
AA seq 361 aa AA seqDB search
MTVSSVVSPGWPGLIEAYRSRLPVTDTTPVVTLQEGATPLVPARELSERTGCEVYLKVEG
ANPTGSFKDRGMTMAISKAVEEGARAVICASTGNTSASAAAYAARAGITCAVLVPQGKIA
MGKLAQALVHGARLLQVQGNFDDCLALASKLAIDYPVSLVNSVNQYRIEGQKTASFEIVD
VLGDAPDIHCLPVGNAGNITAYWQGYREYCADSEAPGPASRAPRMWGFQAAGAAPIVSGQ
VVENPSTIATAIRIGNPASWTKALAARDESGGRIDAVTDRAILSAYRLLARSEAVFVEPA
SAASVAGLLQVAAAGELEPGQRIVCTVTGNGLKDPEWAISGAPAPVTIPVDAAAAASQLG
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacggtctcgtcggtcgtgtccccgggctggccgggcctcatcgaggcctaccgctcc
cggctgccggtcaccgacacgaccccggtggtcaccctccaggagggggcgaccccgctg
gtgccggcccgcgagctgtcggagcggaccggctgcgaggtgtacctcaaggtcgagggc
gccaacccgaccggctccttcaaggaccgcggcatgacgatggccatcagcaaggccgtc
gaggagggggcgcgcgcggtcatctgcgcgtccaccgggaacaccagcgccagcgccgcc
gcctacgccgcgcgcgccggcatcacctgcgccgtcctcgtgccgcagggcaagatcgcg
atgggcaagctggcgcaggcactcgtgcacggcgcgcggctgctgcaggtccagggcaac
ttcgacgactgcctggcactggccagcaagctggccatcgactacccggtcagcctggtc
aacagcgtcaaccagtaccgcatcgaggggcagaagacggcgtccttcgagatcgtcgac
gtgctcggggacgcgcccgacatccactgcctgccggtcggcaacgccggcaacatcacc
gcctactggcagggctaccgggagtactgcgccgactccgaggcccccggccccgcctcc
cgcgcgccccggatgtggggtttccaggccgccggcgcggctccgatcgtcagcgggcag
gtggtggagaacccgagcaccatcgccaccgcgatccggatcggcaaccccgcgtcctgg
accaaggcgctggccgcccgcgacgagtccggcggccgcatcgacgccgtcaccgaccgc
gccatcctgtccgcctaccggctgctggcccgcagcgaggcggtcttcgtcgagcccgcg
tccgcggcgtcggtcgccggtctgctgcaggtggccgctgccggtgagctcgagcccggc
cagcggatcgtctgcaccgtcaccggcaacgggctcaaggacccggagtgggccatctcc
ggggccccggcgccggtcaccatcccggtggacgccgccgccgccgcatcccagctcggc
ctgtga

DBGET integrated database retrieval system