KEGG   Blastococcus saxobsidens: BLASA_3935Help
Entry
BLASA_3935        CDS       T01752                                 

Gene name
thrC2
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLASA_3935 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLASA_3935 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLASA_3935 (thrC2)
Enzymes [BR:bsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLASA_3935 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3802985..3804070)
Genome map
AA seq 361 aa AA seqDB search
MTVSSVVSPGWPGLIEAYRSRLPVTDTTPVVTLQEGATPLVPARELSERTGCEVYLKVEG
ANPTGSFKDRGMTMAISKAVEEGARAVICASTGNTSASAAAYAARAGITCAVLVPQGKIA
MGKLAQALVHGARLLQVQGNFDDCLALASKLAIDYPVSLVNSVNQYRIEGQKTASFEIVD
VLGDAPDIHCLPVGNAGNITAYWQGYREYCADSEAPGPASRAPRMWGFQAAGAAPIVSGQ
VVENPSTIATAIRIGNPASWTKALAARDESGGRIDAVTDRAILSAYRLLARSEAVFVEPA
SAASVAGLLQVAAAGELEPGQRIVCTVTGNGLKDPEWAISGAPAPVTIPVDAAAAASQLG
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacggtctcgtcggtcgtgtccccgggctggccgggcctcatcgaggcctaccgctcc
cggctgccggtcaccgacacgaccccggtggtcaccctccaggagggggcgaccccgctg
gtgccggcccgcgagctgtcggagcggaccggctgcgaggtgtacctcaaggtcgagggc
gccaacccgaccggctccttcaaggaccgcggcatgacgatggccatcagcaaggccgtc
gaggagggggcgcgcgcggtcatctgcgcgtccaccgggaacaccagcgccagcgccgcc
gcctacgccgcgcgcgccggcatcacctgcgccgtcctcgtgccgcagggcaagatcgcg
atgggcaagctggcgcaggcactcgtgcacggcgcgcggctgctgcaggtccagggcaac
ttcgacgactgcctggcactggccagcaagctggccatcgactacccggtcagcctggtc
aacagcgtcaaccagtaccgcatcgaggggcagaagacggcgtccttcgagatcgtcgac
gtgctcggggacgcgcccgacatccactgcctgccggtcggcaacgccggcaacatcacc
gcctactggcagggctaccgggagtactgcgccgactccgaggcccccggccccgcctcc
cgcgcgccccggatgtggggtttccaggccgccggcgcggctccgatcgtcagcgggcag
gtggtggagaacccgagcaccatcgccaccgcgatccggatcggcaaccccgcgtcctgg
accaaggcgctggccgcccgcgacgagtccggcggccgcatcgacgccgtcaccgaccgc
gccatcctgtccgcctaccggctgctggcccgcagcgaggcggtcttcgtcgagcccgcg
tccgcggcgtcggtcgccggtctgctgcaggtggccgctgccggtgagctcgagcccggc
cagcggatcgtctgcaccgtcaccggcaacgggctcaaggacccggagtgggccatctcc
ggggccccggcgccggtcaccatcccggtggacgccgccgccgccgcatcccagctcggc
ctgtga

DBGET integrated database retrieval system