KEGG   Blastococcus saxobsidens: BLASA_4193Help
Entry
BLASA_4193        CDS       T01752                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bsd  Blastococcus saxobsidens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLASA_4193 (deoA)
Enzymes [BR:bsd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BLASA_4193 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4063811..4065082)
Genome map
AA seq 423 aa AA seqDB search
MDAIDVIRAKRDGATLTAEQIRWVIGAYTGGHVPDEQMSALLMAVFFRGMAADELAAWTQ
AMIDSGERKDLSSLGRPTADKHSTGGVGDKITLPLAPLVAACGVAVPQLSGRGLGHTGGT
LDKLEAIPGWRADVHEEAYLQQLRDVGAVICAAGNDLAPADKLLYALRDVTGTVESIPLI
ASSIMSKKIAEGADALVLDVKTGSGAFMKNTEDARTLARTMVGLGEAAGVRTVALVTAMD
RPLGRAAGNAVEVAESVEVLAGGGPADVVELTLALAREMLAGAGRDDVDPADALADGRAM
DVWRRMITAQGGDPDAPLPTPAERHVVTAPATGTLTRLDAFSLGVAAWRLGAGRARKEDP
VSAAAGVVWTAGVGERVTAGQPLLELQTDDPARIPRALEALEGAIGVDTDEQPLPLILDR
ITG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcgacgtcatccgcgcgaagcgggacggcgccacgctgacggccgagcag
atccgctgggtcatcggcgcctacaccggcggtcacgtccccgacgagcagatgagcgcg
ctgctcatggcggtcttcttccgcggcatggccgccgacgagctggccgcgtggacgcag
gcgatgatcgactccggcgagcgcaaggacctctcctcgctcggccggccgaccgcggac
aagcactcgaccggcggcgtcggcgacaagatcaccctgccgctcgcgccgctggtcgcg
gcctgcggcgtggcggtgccgcagctgtccgggcggggtctggggcacaccggcggcacg
ctggacaagctggaggccatccccggctggcgggccgacgtgcacgaggaggcctacctg
cagcagcttcgggacgtcggtgcggtgatctgcgcggcgggcaacgatctcgcgccggcg
gacaagctgctctacgcgctgcgcgacgtcaccggcaccgtcgagtcgatcccgctgatc
gccagctcgatcatgagcaagaagatcgccgagggcgccgacgccctggtgctggacgtg
aagaccggctccggcgccttcatgaagaacaccgaggacgcccgcaccctcgcccgcacg
atggtcggcctgggggaggccgccggtgtgcggacggtggcgctcgtgacggcgatggac
cggccgctgggccgggccgccggcaacgccgtggaggtcgccgagtcggtggaggtgctc
gccggtggtggtcccgccgacgtcgtcgagctcaccctcgcgctggcgcgggagatgctc
gccggcgccgggcgggacgacgtcgaccctgccgacgcgctggccgacggccgggcgatg
gacgtgtggcggcggatgatcaccgcccagggcggggacccggacgccccgctcccgacg
ccggccgagaggcacgtggtgacggcgccggcgaccggcacgctgacccggttggacgcg
ttctcgcttggcgtcgccgcctggcggctcggtgccggtcgcgcccgcaaggaggacccg
gtctcggccgcggccggcgtcgtctggaccgccggggtgggggagcgggtgaccgccggt
cagccgctgctggagctgcagacggacgacccagcacggatcccgcgggcactggaggcc
ctcgagggcgcgatcggcgtcgacacggacgagcagccgctgccgctgatcctggaccgc
atcaccggatga

DBGET integrated database retrieval system