KEGG   Blastococcus saxobsidens: BLASA_4219Help
Entry
BLASA_4219        CDS       T01752                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bsd  Blastococcus saxobsidens
Pathway
bsd00020  Citrate cycle (TCA cycle)
bsd00640  Propanoate metabolism
bsd00660  C5-Branched dibasic acid metabolism
bsd01100  Metabolic pathways
bsd01110  Biosynthesis of secondary metabolites
bsd01120  Microbial metabolism in diverse environments
bsd01130  Biosynthesis of antibiotics
bsd01200  Carbon metabolism
Module
bsd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLASA_4219 (sucC)
   00640 Propanoate metabolism
    BLASA_4219 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BLASA_4219 (sucC)
Enzymes [BR:bsd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BLASA_4219 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: CCG05044
UniProt: H6RLW5
Position
complement(4090563..4091723)
Genome map
AA seq 386 aa AA seqDB search
MDLFEYQARDLLASHGVPVLPGGVAETPEQAEAIAREIGQTVVVKAQVKTGGRGKAGGVK
LADNPDEAKARAQDILGLDIKGHVTHRVMVAQASDIAEEYYFSYLLDRSNRTFLAMASVE
GGVEIEQLAVERPEALARIPIDASVGVDTAKAAEIVDAAGFAPEVRDQVIAIAVQLWDVF
AKEDATLVEVNPLAKAPDGTVLALDAKVTLDENAGFRHAEHAALEDVAAADPLEAAAKEK
DLNYVKLEGEVGIIGNGAGLVMSTLDVVAYAGEEFGGVKPANFLDIGGGASAEVMANGLE
IILSDPAVKSVFVNVFGGITSCDAVANGIVSALGILGDEATKPLVVRLDGNNVEEGRRIL
AEANHPLVTLVDTMDGAARRAAELAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcttcgagtaccaggcccgtgacctgttggcctcgcacggtgtccccgtgctc
cccggtggcgtcgccgagacgcctgagcaggcggaggcgatcgcccgcgagatcgggcag
accgtcgtcgtcaaggcgcaggtgaagaccggcggccgcgggaaggccggtggcgtcaag
ctcgccgacaaccccgacgaggcgaaggcgcgcgcccaggacatcctgggcctggacatc
aagggacacgtcacgcaccgcgtgatggtcgcccaggccagcgacatcgccgaggagtac
tacttctcctacctgctcgaccgctccaaccgcaccttcctggccatggccagcgtcgag
ggcggcgtggagatcgagcagctcgccgtcgagcgcccggaggcgctggcccgcatcccg
atcgacgcctccgtcggcgtggacaccgccaaggccgccgagatcgtggacgccgccggg
ttcgcccccgaggtccgcgaccaggtcatcgccatcgccgtgcagctgtgggacgtcttc
gccaaggaggacgccaccctggtcgaggtcaaccccctcgccaaggcgcccgacggcacc
gtcctggccctcgacgccaaggtcaccctcgacgagaacgccggcttccggcacgccgag
cacgccgcgctcgaggacgtcgcggctgccgacccgctcgaggccgcggccaaggagaag
gacctcaactacgtcaagctcgagggcgaggtcgggatcatcggcaacggcgccgggctg
gtcatgagcaccctggacgtcgtcgcctacgccggtgaggagttcggcggcgtcaagccg
gccaacttcctcgacatcggcggtggcgcctcggccgaggtcatggccaacggcctggag
atcatcctctccgacccggccgtgaagagcgtcttcgtcaacgtcttcggcggcatcacc
tcctgcgacgccgtcgcgaacggcatcgtctccgccctgggcatcctgggcgacgaggcg
accaagccgctggtggtccggctcgacggcaacaacgtcgaggagggccggcgaatcctc
gccgaggccaaccacccgctggtcaccctggtcgacacgatggacggcgccgcgcgccga
gccgccgaactcgccgcctga

DBGET integrated database retrieval system