KEGG   Blastococcus saxobsidens: BLASA_4554Help
Entry
BLASA_4554        CDS       T01752                                 

Definition
inositol monophosphatase (EC:3.1.3.-)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bsd  Blastococcus saxobsidens
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BLASA_4554
Enzymes [BR:bsd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BLASA_4554
Transfer RNA biogenesis [BR:bsd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    BLASA_4554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4379670..4380410
Genome map
AA seq 246 aa AA seqDB search
MSIDDTAVAALAARAAADALVPLRSSGLTGRPLGDAGDAAGQRAIVAVLAAERPDDVVFS
EEAVDDARRLSAGRVWIVDPLDGTREYGNPERSDWAVHVALWADGDLVAAAVALPALGQV
HVTDPAPPLPPRPDGPVRIAVSRTRPPAEAQAVAAALGGELVPLGSAGYKTLAVVRGEAD
AYVHSGGMYQWDSAAPVAVARAAGLVTCRLDGSPLVYNRPDPSLPDLVVTRPELADRVLA
AVRSAR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgacgacaccgcggtcgcggcactggccgcgcgggccgccgccgatgccctg
gtgcccctgcgctcctcgggcctcaccggccggccgctcggggacgccggggacgcggcc
gggcagcgggcgatcgtcgcggtgctcgccgccgagcggcccgacgacgtggtgttcagc
gaggaggccgtcgacgacgctcggcggctgtcggccggccgggtctggatcgtcgacccg
ctggacggcacccgcgagtacgggaacccggagcgctccgactgggccgtccacgtggcg
ctctgggccgacggcgacctcgtggcggccgccgtcgcgctgcccgccctgggccaggtg
cacgtcaccgacccggcgcccccactgccaccccgcccggacggaccggtccggatcgcc
gtcagccgcacccgcccaccggccgaggcgcaggcggtggcggccgcgctcggcggggag
ctggtgccgctgggctcggccggctacaagacgctggccgtcgtccgcggggaggccgac
gcctacgtgcactcgggcggcatgtaccagtgggactccgccgccccggtcgccgtcgcc
cgcgccgccgggctggtcacctgccggctggacgggtcgccgctggtctacaaccggccc
gacccctccctccccgacctcgtggtcacccggccggagctggccgaccgggtgctggct
gcggtccgctcggcgcgatag

DBGET integrated database retrieval system