KEGG   Blastococcus saxobsidens: BLASA_4753Help
Entry
BLASA_4753        CDS       T01752                                 

Gene name
btuE
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bsd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BLASA_4753 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BLASA_4753 (btuE)
Enzymes [BR:bsd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BLASA_4753 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4575561..4576055
Genome map
AA seq 164 aa AA seqDB search
MTDLLDLPVTTLQGTPTTLRELTGGAPALVVNVASRCGLTSQYAALEALHEEFRDRGFTV
IGVPCNQFKGQEPGTAEEIAEFCSATYGVTFPMTEKLEINGPGAHPLFQELTGVPDVDGT
AGDAQWNFEKWVLSGQGEVVARFRPRTEPDAPEVRAAIESVLPG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcctcgacctgcccgtgaccacgctgcaggggacgccgaccacgctgcgg
gagctgaccggcggcgcaccggcgctcgtggtgaacgtggccagccggtgcgggctcacg
tcccagtacgcggccctggaggcgctgcacgaggagttccgcgaccgcggcttcaccgtg
atcggcgtgccgtgcaaccagttcaaggggcaggagccgggcaccgccgaggagatcgcc
gagttctgctccgcgacctacggcgtcaccttcccgatgaccgagaagctcgagatcaac
ggcccgggggcgcacccgctgttccaggagctcaccggcgtcccggacgtggacgggacg
gccggtgacgcccagtggaacttcgagaagtgggtgctcagcggccagggcgaggtggtc
gcccggttccggccgcgcaccgagcccgacgcccccgaggtgcgcgccgcgatcgagtcg
gtgctccccggctga

DBGET integrated database retrieval system