KEGG   Blastococcus saxobsidens: BLASA_4753Help
Entry
BLASA_4753        CDS       T01752                                 

Gene name
btuE
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bsd  Blastococcus saxobsidens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bsd00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bsd00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4575561..4576055
Genome map
AA seq 164 aa AA seqDB search
MTDLLDLPVTTLQGTPTTLRELTGGAPALVVNVASRCGLTSQYAALEALHEEFRDRGFTV
IGVPCNQFKGQEPGTAEEIAEFCSATYGVTFPMTEKLEINGPGAHPLFQELTGVPDVDGT
AGDAQWNFEKWVLSGQGEVVARFRPRTEPDAPEVRAAIESVLPG
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcctcgacctgcccgtgaccacgctgcaggggacgccgaccacgctgcgg
gagctgaccggcggcgcaccggcgctcgtggtgaacgtggccagccggtgcgggctcacg
tcccagtacgcggccctggaggcgctgcacgaggagttccgcgaccgcggcttcaccgtg
atcggcgtgccgtgcaaccagttcaaggggcaggagccgggcaccgccgaggagatcgcc
gagttctgctccgcgacctacggcgtcaccttcccgatgaccgagaagctcgagatcaac
ggcccgggggcgcacccgctgttccaggagctcaccggcgtcccggacgtggacgggacg
gccggtgacgcccagtggaacttcgagaagtgggtgctcagcggccagggcgaggtggtc
gcccggttccggccgcgcaccgagcccgacgcccccgaggtgcgcgccgcgatcgagtcg
gtgctccccggctga

DBGET integrated database retrieval system