KEGG   Blastococcus saxobsidens: BLASA_4962Help
Entry
BLASA_4962        CDS       T01752                                 

Gene name
cheB
Definition
Chemotaxis response regulator protein CheB-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bsd  Blastococcus saxobsidens
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bsd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bsd02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4758004..4759128)
Genome map
AA seq 374 aa AA seqDB search
MNPIRVMVVDDSVVVRKIVTDVLSADPGIEVVGTAVNGKVALAKLEQLKPDLVTMDIEMP
EMNGIEAVRAIRGGGAGRGHSRLPIIMFSTLTERGATATLDALSAGANDYVTKPANVGSV
AQSMESVREQLIPRIKALTGRPVTTVARAAAPVAPPRPAAPRTAPGKKPAVLVIGSSTGG
PEALARVLPALPANLPVPVLLAQHMPPVFTRQFAQRLDRLCALRVVEAVDGTPLVPGTVH
LAPGDHHLVVRANGRASYATSLNQSPPVNFCRPAVDPLFRSAVAAYDGAVLGVVLTGMGA
DGRNGCGEVRDAGGTVVVQDQTTSVVWGMPGAVAQAGYADEVLPLDRVAEAIQRHLAGAA
PLNATTAMAVGGRR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccgatcagggtgatggtggtcgacgactcggtcgtcgtccgcaagatcgtcacc
gatgtgctctccgcggacccggggatcgaggtcgtgggcaccgccgtcaacggcaaggtc
gccctggccaagctcgagcagctcaagcccgacctggtgaccatggacatcgagatgccg
gagatgaacggcatcgaggcggtgcgggccatccgcggcggcggcgcgggacgagggcac
agccgcctgccgatcatcatgttcagcacgctcaccgagcgcggcgccaccgcgaccctc
gacgccctgtcggcaggggccaacgactacgtcaccaagccggccaacgtcggcagcgtg
gcccagtcgatggagagcgtccgcgagcagctgatccccaggatcaaggcgctcaccggc
cgcccggtgacgacggtggcacgcgcggccgcacccgtggcaccgccgcgcccggccgcc
ccgcgcaccgcccccggcaagaagccggccgtgctggtcatcggttcctccaccggcggc
cccgaggcgctggcccgcgtgctgccggccctgccggccaacctgccggtgccggtcctg
ctggcccagcacatgccgccggtgttcacccgtcagttcgcccagcgcctggaccggctc
tgcgcgctgcgcgtggtggaggccgtcgacgggacgccgctggtgcccggcaccgtgcac
ctggcgcccggcgaccaccacctggtcgtgcgcgccaacggccgggcgtcctacgccacg
tcgctgaaccagagcccgccggtgaacttctgccggcccgcggtcgacccgctcttccgc
tcggccgtcgcggcctacgacggtgcggtgctcggtgtggtcctcaccggcatgggcgcc
gacggccgcaacggctgcggggaggtccgcgacgccggcggcaccgtcgtcgtgcaggac
cagacgacctcggtcgtgtggggcatgccgggcgccgtcgcccaggccggctacgccgac
gaggtcctgccgctcgaccgggtcgccgaggccatccagcggcacctcgccggtgccgcg
ccgctgaacgcaacaaccgctatggccgtgggaggtcgtcgatga

DBGET integrated database retrieval system