KEGG   Bacillus selenitireducens: Bsel_0075Help
Entry
Bsel_0075         CDS       T01243                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bse  Bacillus selenitireducens
Pathway
bse00790  Folate biosynthesis
bse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bsel_0075
Enzymes [BR:bse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Bsel_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ADH97625
JGI: Bsel_0075
UniProt: D6XV67
Position
85137..85658
Genome map
AA seq 173 aa AA seqDB search
MHTDAAKHAFIAFGSNQGERIDCLKKALKALSDHPDLSLVDVSAIYETAPVGMTDQPSFL
NMVAVFHSKLTAEALLNVTQSIEQDGGRERKERWGPRTIDLDILRHGTDTVDTAHLQIPH
PRMMERAFVLVPLLDVAHHDPALCEDTLHEALKGCADRADVKRISDGLPDVDA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcacactgatgcggcaaagcatgcttttatcgcgttcggctccaatcagggggagcgg
atcgattgtctgaagaaagccctgaaggccttgagcgaccaccccgacctgtcgctggtg
gacgtttctgcgatctatgagacggcccctgtcggcatgaccgatcagccgtctttttta
aatatggtcgcggtcttccactcgaagctgactgccgaagcacttttgaacgtgacccag
tcgattgaacaggacggggggcgtgagcgcaaggagcggtggggtccgcgaaccattgat
ctcgatatcctccgtcacggaaccgatacggtcgatacggcgcatttgcaaatcccgcat
ccgcgtatgatggagcgggcttttgtcctggttccgcttctcgatgtggcccatcacgat
cctgctctatgcgaagatacactgcacgaggccctcaaaggatgcgctgacagagcggac
gtcaagcggatttctgacgggctgccggacgtggatgcatga

DBGET integrated database retrieval system