KEGG   Bacillus selenitireducens: Bsel_0089Help
Entry
Bsel_0089         CDS       T01243                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bse  Bacillus selenitireducens
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bse00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bsel_0089
Enzymes [BR:bse01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Bsel_0089
Amino acid related enzymes [BR:bse01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Bsel_0089
Transfer RNA biogenesis [BR:bse03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Bsel_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
112188..113642
Genome map
AA seq 484 aa AA seqDB search
MSNDIRVRFAPSPTGHLHIGGARSALFNYLFARNQGGKFIVRIEDTDQARNVETATEKLM
ESMKWLGIDWDESVDVGGPHAPYRSMERLDLYNRYVDQLLKEGKAFHCYMTEEELEAERE
EQRKRGETPMYSGRDRHLTDEQKRAYEAEGKKPVVRFMVPKGQEIVVDDAVRGKVTFDSD
GIGDFVIVRTDGIPTYNFAVTVDDHTMGISHVIRGEEHLSNAPLQVMLYEALGFETPTFA
HASLILNEDRQKMSKRDESIIQFVEQYRDLGYMPEAIVNFIALLGWSPGGEQEIMTKNEL
IEAFSLDRVVKAPAVFDTKKLSWMNNQYMKEADDDQVVWLAQPHLQKAGKLPEMMSDEQK
QWAYDLIVLHKEKMDCGADIVPLTELFFQDEIEYDEDAKAILGEEQVPEVLEAFLKNLDS
LEEFEAAAIKKAMKDVQKSTGHKGKKLFMPIRVAVSGQQHGPDLPQMIALLGRTVVTTRL
KGLL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgacatccgggtgcgttttgcacccagcccgacaggccatctgcacattgga
ggtgcacgatcggccctgttcaactatttgtttgcccgtaatcagggcgggaaattcatc
gtgcgcattgaagacacagatcaggcacggaacgtggagacagcgacggaaaagctgatg
gaaagcatgaaatggctcggtatcgactgggatgaatccgtcgacgtcggcggtccgcac
gccccgtaccgaagcatggaacgacttgatctgtataaccgctatgtggatcagctcttg
aaagaaggcaaggcctttcactgttacatgacggaagaagagcttgaagcagagcgcgaa
gagcagcgaaaacgcggcgagacgccgatgtacagcggccgtgaccgccatttgaccgat
gaacagaagcgtgcctacgaagcggaagggaagaaaccggttgtccgtttcatggtaccg
aaaggacaggagatcgtcgttgatgatgccgtccgcggcaaggtcaccttcgactctgac
gggatcggtgatttcgtcatcgtccgtacagacgggattccgacctataacttcgcggtg
acggtcgatgaccatacgatggggatcagccacgtgatccgcggggaggagcacctctct
aatgcgccccttcaggtgatgctgtatgaggcactcgggtttgaaacgccgacgtttgcc
catgcgtcactcattttgaacgaggaccgtcaaaagatgagcaagcgtgacgagtcgatc
attcagttcgtggaacagtaccgcgaccttggctatatgcctgaagcgatcgtgaacttc
atcgccctccttggctggagcccgggtggcgaacaggaaatcatgacgaagaacgagctt
atcgaagccttcagtctcgatcgtgtcgtgaaagcccctgcggttttcgatacgaagaag
ctgtcctggatgaacaatcagtatatgaaagaagcggacgacgaccaggtggtctggctc
gctcagcctcacctgcaaaaggcagggaagctgccggagatgatgagcgacgaacagaag
cagtgggcgtacgacctgattgttcttcataaggaaaagatggactgcggtgcggatatc
gtcccgttgacggagctctttttccaagatgagattgagtacgatgaggacgcgaaggcg
attcttggcgaagaacaggtaccggaagtgctcgaagccttcctgaagaacctcgacagc
cttgaggaatttgaagcggccgctatcaaaaaagccatgaaagatgtgcagaaatcaacg
ggacataagggcaaaaagctcttcatgccgatccgtgtggccgtctcaggccagcagcac
ggcccggatctcccgcaaatgatcgcgcttctcggcagaacagttgtcacaacccgcctg
aaagggttattataa

DBGET integrated database retrieval system