KEGG   Bacillus selenitireducens: Bsel_0282Help
Entry
Bsel_0282         CDS       T01243                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bse  Bacillus selenitireducens
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bsel_0282
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bsel_0282
Enzymes [BR:bse01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bsel_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(293243..293812)
Genome map
AA seq 189 aa AA seqDB search
MSVYDFKVKTSSGLNAPLNRYQGKVLLIVNTATKCGFTPQLDDLQKLQDQYGEQGLQILG
FPSNQFDNQEPLGDGEITEFCSLNYGVNFPLFKKIDVRGEDAHPLYQHLTKAKPFNGFDM
DHPTAKLMVSIIESKHPEYMLDDGIKWNFTKFLIDRNGEVTARFEPTVEPFDMKADIEAL
LQSETALNQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatacgatttcaaagtcaaaacatccagcgggctgaatgccccattgaaccga
tatcagggaaaggtgctcctcatcgtcaatacggcgacgaaatgcggcttcaccccacag
ctcgatgaccttcagaaattgcaggatcagtacggtgagcagggtcttcagatcctcggc
ttcccgtccaatcagtttgacaaccaggaaccccttggcgacggtgagatcaccgagttc
tgttcgttgaactacggcgtgaactttcccctctttaagaagattgacgtccgcggagaa
gatgcccatccgctgtatcagcacctgacaaaagccaagcctttcaatggcttcgacatg
gatcatccgacggcgaagctgatggtctccatcattgagagcaagcacccggagtacatg
ctcgatgacggcatcaaatggaacttcacaaagtttctgatcgaccggaatggtgaagtg
acagcacgattcgaaccgactgttgaaccattcgacatgaaggccgatatcgaggcattg
cttcaaagtgaaacagcactaaaccaataa

DBGET integrated database retrieval system