KEGG   Bacillus selenitireducens: Bsel_0425Help
Entry
Bsel_0425         CDS       T01243                                 

Definition
MCP methyltransferase/methylesterase CheR/CheB (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
bse  Bacillus selenitireducens
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bse00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bsel_0425
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bsel_0425
Enzymes [BR:bse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Bsel_0425
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bsel_0425
Two-component system [BR:bse02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Bsel_0425
Bacterial motility proteins [BR:bse02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bsel_0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
449168..452089
Genome map
AA seq 973 aa AA seqDB search
MTREMYYVGVGASAGGLEALESFFNPMPDDTGLVFIVVQHLSPDFKSLMNELLARYTNMK
IHVAEDGMVTEPDHVYLIPPGYNLSIFHGRLLLDRQDERNHLNLPIDIFFRSLALDQEKQ
AIGVILSGTGSDGTLGVRAIKESGGMIMVQSEASAKFDGMPRSSIATGLVDAILHPEQMA
EELMNYVKSPSLQEKWSRNGTNDHQGGLDGLTRIGQIMRSHGGIDFSSYKDTTIIRRIDR
RIKINRLHDLDDYIRFLKESGEERDVLQREFLIGVTAFFRDQDAFDVLLEKVIPKLDYKK
GLIRVWSAACSTGEEVYSLAMLFHEYIQQHNLDCQVKLFATDVDERALELAGTGYYPDSL
IADIDPDLVSRYFIKKEGGYQVTEAIRKMVVFAKHNILRDPPFSKLDLLVCRNLFIYLKS
EHQRTILNSFYYSLKPNGYLFLGSSETLGELSEGFAAVDAKWKIYQYKAGYKPDIETGTL
LPGYRAEAREVRQERDTDMRGSMKMESLLSEAMASISPPSLIIDRQDEIVHVVNDVSRFI
RTQPGRFSNSYHTNMNKEQSLFVSNILRRLKHERQDVTITNVSNFTESDATLTLAGRIFQ
VRGEDYFLISFMEQKGAAHKGKTVDIDMSEEARERVEELEGELQLAREGLQATIEELETS
NEELQSSNEELIASNEELQSTNEELQSVNEELYTVNAEHQMKIDELVKLNNDLNNLIRNT
EVGALYLDQSLRIRKLTPVISEVTNILDSDIGRPISHISFIDGYPELIKNIEEVQDTLSP
VERQLKLKNDLWYIIRIRPYRTEYNAAEGIIITLVNITGLKDEERKVRLAHDRLTHAMAT
GDMAWWEFHVPTGHIRYSERLATMMGYEPEEFPNDIQVWMRLIHPDDRAMVRSKMKAFQE
GDDPILDRIYRIQRKDQSYAWFHDKADVIEWKKDGTPARIAGTAIDISRYKYLESELREM
QEKDRSSQKGDGI
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgaccagagagatgtattatgttggggtgggggcttcggccggcggccttgaagccctt
gaatcattttttaatcccatgccggatgacacgggacttgtgttcatcgttgtccagcat
ttatccccggacttcaaaagtctgatgaatgaacttctggcacggtatacgaatatgaag
attcatgtggctgaagacggcatggtgacggaaccggaccatgtctatctgatcccgcca
ggatacaatctctccatttttcatgggcggctcttactcgacaggcaggatgagcggaat
cacctgaacctgcccattgatatctttttccgttccctcgcactcgatcaggagaagcag
gcaatcggggttattctgtccggaaccggcagtgacggcaccctcggtgtgcgggcgatc
aaggaatcaggcggtatgatcatggtgcagtcggaggcttccgccaagttcgacgggatg
cctagaagctccattgcaaccggtcttgtcgatgcgattttacacccggaacagatggcg
gaagagctgatgaactatgtcaaatccccatccctgcaggaaaaatggagccggaacggt
acgaatgatcaccagggcggactcgacgggctgacacggatcggtcagatcatgcggagc
cacggcgggattgacttctcgagttacaaagacacgaccattatccggcggatcgaccgg
cggattaagatcaaccggctgcacgatctcgatgattacatccggtttttgaaggaatca
ggagaagaacgggatgtgctgcagcgggaattcctgatcggcgtcacggccttttttcgg
gatcaggacgcttttgacgtactgttggaaaaggtgatcccgaaactcgattacaaaaag
gggcttattcgtgtctggtctgcggcctgttcgacaggagaagaagtctattcccttgcg
atgcttttccatgaatatatccagcaacataatctcgactgtcaggtgaaacttttcgcg
acggatgtggatgagcgggcccttgaacttgccggaaccggctactacccggacagcctg
atcgcggatattgatccggatctcgtatcccgttactttattaaaaaagaaggcggctac
caggtgacggaggcaatacggaagatggttgtcttcgccaagcacaatattcttcgggac
ccgcccttttcgaaactggatctgctcgtctgccgcaatctgtttatttatttaaagagt
gagcatcagcgcaccatattaaacagcttttattattcgcttaagccgaacggctatctg
tttctcggcagcagtgagaccctcggtgaactctctgaagggttcgcagccgtcgatgca
aagtggaagatttatcagtataaagccggctataaaccggacattgaaaccgggactctc
cttcccggctaccgggcagaggcaagggaagtccggcaggagcgggataccgacatgaga
ggcagtatgaagatggaatcgctcttaagtgaagcgatggcctcgatctccccgccatcc
ctgatcattgacaggcaggatgaaatcgtccatgtggtcaacgatgtttcccggttcatc
cggacacagccgggccggttttcgaacagctaccatacgaacatgaacaaggaacagtcg
ctgtttgtcagcaacatcttacgcagactcaaacatgaacgtcaggatgtcacgatcacg
aacgtctcgaacttcaccgaatcggacgccacgctgacgctcgcgggccggatctttcag
gttcggggagaggattattttctgatcagctttatggaacagaaaggcgccgctcataaa
gggaagaccgttgacattgacatgtccgaagaggcgagagagcgggtagaggagctagaa
ggtgagctgcagcttgcgagagaaggacttcaggcgacgatcgaggagctggagacgtcc
aatgaagaactgcagtcgtcgaatgaagaactgattgcgagtaatgaagagctgcagagt
acgaatgaggagctgcagtcggtcaatgaagaactctataccgtcaatgccgagcaccag
atgaagatcgatgagcttgtcaaactcaataatgatctgaacaacctgatccgaaatacg
gaggttggcgctctctacctcgatcagtcgcttcggatccgaaagctcacaccggtcatt
tcagaggtgacgaatatcctcgattcagacatcggacggccgatttcacatatttcgttt
atcgacggctatccggaactcatcaaaaacattgaagaggtgcaggacaccctctccccg
gtggagagacagctgaagctgaaaaacgatctctggtatatcatccgtatccggccttac
cgcacagaatacaatgccgcagaggggatcatcattacccttgtcaatatcaccggtctg
aaggacgaagaacgcaaagtgcgcctcgcccatgaccgcctgacccacgccatggcgacg
ggggatatggcatggtgggaatttcatgtgccgacgggccatatccgttattcagaacga
cttgcgaccatgatgggttacgagccggaagaattcccgaatgatatacaggtctggatg
cggcttattcatccggacgaccgggcaatggtccgctcgaagatgaaagcctttcaggaa
ggggacgatccgattctcgaccggatctaccggattcaacgtaaggatcagtcttatgcg
tggtttcatgacaaggcggatgtgattgaatggaagaaggatggcacgcccgcaagaatc
gcggggacggccatcgatatcagccggtacaagtatttggagagcgaactccgtgagatg
caggaaaaagacaggtcaagccaaaagggagacggaatatga

DBGET integrated database retrieval system