KEGG   Bacillus selenitireducens: Bsel_0523Help
Entry
Bsel_0523         CDS       T01243                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bse  Bacillus selenitireducens
Pathway
bse00220  Arginine biosynthesis
bse00330  Arginine and proline metabolism
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01130  Biosynthesis of antibiotics
bse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Bsel_0523
   00330 Arginine and proline metabolism
    Bsel_0523
Enzymes [BR:bse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bsel_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADH98059
JGI: Bsel_0523
UniProt: D6XXY6
Position
555042..555944
Genome map
AA seq 300 aa AA seqDB search
MNRQLSIIGVPMDLGQNRRGVDMGPSAMRYAGVVDRLTALGYEVEDRGDVRIGRSSEEEE
SQSNLKDLHEVVDANKALAKEVKSVVEAERFPLVLGGDHSIAIGTLAGVSEPFENMGVIW
YDAHGDLNTGETSPSGNIHGMPLAVSLGIGHPSLTEIGGYAPKVKPENIVIIGARSLDEG
ERKLIREKGIQVYTMHEVDRYGMSHVMQEALSYLKDRQTDGVHLSLDLDALDPQDAPGVG
TPVLGGTSYRETHLAMEILADADILTSAEFVEVNPILDVKNKTAEAGVGLIGSLFGEKLL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacagttatcgattatcggcgtcccgatggacctcggtcaaaatcgccgggga
gtggatatgggaccgagtgcgatgcgttatgccggggtggtggatcgcctgacggcactc
gggtatgaggtggaagaccgcggtgatgtccgcattggcagatcctctgaagaagaggaa
agccagtcaaatctcaaggatctgcatgaagtggtggatgccaacaaggcgcttgccaaa
gaggtgaagtctgtagttgaagcagaacgctttcctctcgttctcggtggggatcacagc
atcgcgattgggacgcttgccggtgtctcggaaccgtttgaaaacatgggagtgatctgg
tacgacgcccatggtgatctgaataccggggagacgtccccttcgggtaatattcacggg
atgccccttgcggtgagccttgggatcgggcatccgtccctgacggaaatcggcggatac
gcaccaaaggttaaaccggaaaatatcgtgatcatcggtgcaagatccctcgatgaaggc
gaacggaagctgatcagggaaaaagggattcaggtgtatacgatgcatgaggtggaccgg
tacgggatgtctcatgttatgcaggaggcactgtcgtacctgaaagacaggcagacggac
ggcgttcatttaagtcttgatcttgatgcccttgatcctcaggatgcaccgggtgtcggg
acaccggtgcttggaggcacgtcctaccgggagacgcatcttgccatggagatcctcgca
gatgccgacatcctgacatctgcggagttcgttgaggtgaatccgattctcgacgtaaag
aacaagacagccgaagcgggtgttggtctcatcggatcactgttcggagagaaactgctc
tga

DBGET integrated database retrieval system