KEGG   Bacillus selenitireducens: Bsel_0523Help
Entry
Bsel_0523         CDS       T01243                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bse  Bacillus selenitireducens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bsel_0523
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bsel_0523
Enzymes [BR:bse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bsel_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
555042..555944
Genome map
AA seq 300 aa AA seqDB search
MNRQLSIIGVPMDLGQNRRGVDMGPSAMRYAGVVDRLTALGYEVEDRGDVRIGRSSEEEE
SQSNLKDLHEVVDANKALAKEVKSVVEAERFPLVLGGDHSIAIGTLAGVSEPFENMGVIW
YDAHGDLNTGETSPSGNIHGMPLAVSLGIGHPSLTEIGGYAPKVKPENIVIIGARSLDEG
ERKLIREKGIQVYTMHEVDRYGMSHVMQEALSYLKDRQTDGVHLSLDLDALDPQDAPGVG
TPVLGGTSYRETHLAMEILADADILTSAEFVEVNPILDVKNKTAEAGVGLIGSLFGEKLL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacagttatcgattatcggcgtcccgatggacctcggtcaaaatcgccgggga
gtggatatgggaccgagtgcgatgcgttatgccggggtggtggatcgcctgacggcactc
gggtatgaggtggaagaccgcggtgatgtccgcattggcagatcctctgaagaagaggaa
agccagtcaaatctcaaggatctgcatgaagtggtggatgccaacaaggcgcttgccaaa
gaggtgaagtctgtagttgaagcagaacgctttcctctcgttctcggtggggatcacagc
atcgcgattgggacgcttgccggtgtctcggaaccgtttgaaaacatgggagtgatctgg
tacgacgcccatggtgatctgaataccggggagacgtccccttcgggtaatattcacggg
atgccccttgcggtgagccttgggatcgggcatccgtccctgacggaaatcggcggatac
gcaccaaaggttaaaccggaaaatatcgtgatcatcggtgcaagatccctcgatgaaggc
gaacggaagctgatcagggaaaaagggattcaggtgtatacgatgcatgaggtggaccgg
tacgggatgtctcatgttatgcaggaggcactgtcgtacctgaaagacaggcagacggac
ggcgttcatttaagtcttgatcttgatgcccttgatcctcaggatgcaccgggtgtcggg
acaccggtgcttggaggcacgtcctaccgggagacgcatcttgccatggagatcctcgca
gatgccgacatcctgacatctgcggagttcgttgaggtgaatccgattctcgacgtaaag
aacaagacagccgaagcgggtgttggtctcatcggatcactgttcggagagaaactgctc
tga

DBGET integrated database retrieval system