KEGG   Bacillus selenitireducens: Bsel_0582Help
Entry
Bsel_0582         CDS       T01243                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
bse  Bacillus selenitireducens
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bse00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
627892..628848
Genome map
AA seq 318 aa AA seqDB search
MSERTMLYGKGDVFVYRTYATPLKGVRQIPESNFTGRSNTIFGMDIQVSLAGEAFLTSFT
EGDNAKVVATDSMKNFILHHAGEYEGTTMEGFLAYVSACFLDTYDHISEVEMSGRQFPFE
AVEVGSPAGVVPSETVFREGMLEKPGTRISVGRDENGEAQIGSLESAVHDLHLIKVKGSS
FAGFIRDEYTTLPETKDRPLFIYLNISWTYKETEHALGATPEQYVAAEQVKHIAQTLFHQ
EDSPSIQKLIYDIGIRVLERFPQLETVSFESNNRTWETVRDEIPASGEGKVFTDPRPPFG
FQKFTVLQEDVKREEALR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgaacgatgttatacggcaaaggggacgtttttgtctaccgcacatacgct
acaccgcttaaaggggtcagacagatccctgaatcaaatttcacaggaagatcaaatacg
attttcggtatggatatccaggtatctctcgccggtgaagccttcctgacgtctttcact
gaaggggacaatgccaaagtggtggcgacggattcgatgaagaacttcattctccatcac
gccggagaatatgaagggacgacgatggaaggtttcctcgcctatgtgagtgcctgcttc
cttgatacgtatgaccatatttcagaggtggagatgtcaggaagacagtttccgttcgaa
gcggtcgaagtcggttcaccagccggcgtcgtgccgagtgagacggtgtttcgggaaggg
atgcttgaaaaaccggggacccgtatcagcgttggacgtgatgagaacggcgaagcacag
atcggttctctcgaaagcgctgtgcatgatctgcatctgattaaagtgaaaggaagcagc
tttgcgggctttatccgcgatgaatatacaaccctgccggaaacgaaggaccgtccgctc
tttatttatctgaacatcagctggacgtacaaagagacggagcatgccctcggagcgacc
cccgagcagtacgtggcagcagaacaggtcaagcacatcgcccagaccctctttcatcag
gaagattcgccgtccatccagaagctgatctatgacatcggtattcgcgtccttgagcgt
ttcccccagcttgaaacggtttcctttgaatcgaataaccgtacgtgggaaacggtacgc
gacgagattccggcatccggtgaaggcaaggtcttcacggatccgaggccgccgttcggc
tttcagaaattcacggtccttcaggaggatgtgaagcgtgaggaggccctccgctga

DBGET integrated database retrieval system