KEGG   Bacillus selenitireducens: Bsel_1115Help
Entry
Bsel_1115         CDS       T01243                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bse  Bacillus selenitireducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsel_1115
   01230 Biosynthesis of amino acids
    Bsel_1115
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_1115
   00051 Fructose and mannose metabolism
    Bsel_1115
   00562 Inositol phosphate metabolism
    Bsel_1115
Enzymes [BR:bse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bsel_1115
Exosome [BR:bse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bsel_1115
  Exosomal proteins of bladder cancer cells
   Bsel_1115
  Exosomal proteins of melanoma cells
   Bsel_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1288879..1289637
Genome map
AA seq 252 aa AA seqDB search
MRKPIIAGNWKMNKTKSEAVEFLQAIKTAVPSADKVDSVVCSPHLYLDALVQEAAGTDVK
IGAQNMYFEESGAFTGETSPMALNDLGVTYVVLGHSERRELFGETDESVNKKTHAAFSHG
LTPIVCVGETLEEREANKTSDVVTLQVKEGLKGLTADQVKETVVAYEPIWAIGTGKTATS
EDANETCGVIRKVIAGEFGQDVADAVRIQYGGSVKPANIKELLEQSDIDGALVGGASLEA
ESYLQLVEAGNE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgattatcgcaggaaactggaagatgaataaaacgaagtctgaagcagtt
gaatttttgcaggcgattaagaccgctgtaccgtccgcggacaaagtggacagcgtcgtc
tgctccccgcatctgtacctcgatgccctcgttcaggaagcagcgggcacggatgttaag
atcggtgcacagaacatgtacttcgaagagagcggtgcgttcacgggtgaaacaagcccg
atggcactgaatgacctcggtgtcacctatgtggtcctcggtcactccgagcgccgtgaa
ctctttggagaaaccgacgagtccgtgaataaaaagacccacgcagccttcagccatggt
ctgacaccaatcgtctgtgtcggagagacccttgaagagcgtgaagcaaacaaaacgtct
gacgttgtgacgcttcaggtgaaagaaggcctgaaaggactcacggcagatcaggtcaaa
gagaccgtcgttgcctatgagccgatctgggcgatcggaaccggcaagacagcgacttca
gaagatgccaacgaaacatgcggcgtcatccgtaaagtcattgccggagaattcggtcag
gacgtcgcggatgcggtacgcattcagtacggcggcagcgttaagcctgcgaacattaaa
gagctccttgagcaatctgatatcgatggcgccctggttggcggcgcaagcctggaagcg
gaatcctatcttcagctcgtagaggctggcaatgagtaa

DBGET integrated database retrieval system