KEGG   Bacillus selenitireducens: Bsel_1115Help
Entry
Bsel_1115         CDS       T01243                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bse  Bacillus selenitireducens
Pathway
bse00010  Glycolysis / Gluconeogenesis
bse00051  Fructose and mannose metabolism
bse00562  Inositol phosphate metabolism
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01120  Microbial metabolism in diverse environments
bse01130  Biosynthesis of antibiotics
bse01200  Carbon metabolism
bse01230  Biosynthesis of amino acids
Module
bse_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_1115
   00051 Fructose and mannose metabolism
    Bsel_1115
   00562 Inositol phosphate metabolism
    Bsel_1115
Enzymes [BR:bse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bsel_1115
Exosome [BR:bse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bsel_1115
  Exosomal proteins of bladder cancer cells
   Bsel_1115
  Exosomal proteins of melanoma cells
   Bsel_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADH98633
JGI: Bsel_1115
UniProt: D6Y129
Position
1288879..1289637
Genome map
AA seq 252 aa AA seqDB search
MRKPIIAGNWKMNKTKSEAVEFLQAIKTAVPSADKVDSVVCSPHLYLDALVQEAAGTDVK
IGAQNMYFEESGAFTGETSPMALNDLGVTYVVLGHSERRELFGETDESVNKKTHAAFSHG
LTPIVCVGETLEEREANKTSDVVTLQVKEGLKGLTADQVKETVVAYEPIWAIGTGKTATS
EDANETCGVIRKVIAGEFGQDVADAVRIQYGGSVKPANIKELLEQSDIDGALVGGASLEA
ESYLQLVEAGNE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgattatcgcaggaaactggaagatgaataaaacgaagtctgaagcagtt
gaatttttgcaggcgattaagaccgctgtaccgtccgcggacaaagtggacagcgtcgtc
tgctccccgcatctgtacctcgatgccctcgttcaggaagcagcgggcacggatgttaag
atcggtgcacagaacatgtacttcgaagagagcggtgcgttcacgggtgaaacaagcccg
atggcactgaatgacctcggtgtcacctatgtggtcctcggtcactccgagcgccgtgaa
ctctttggagaaaccgacgagtccgtgaataaaaagacccacgcagccttcagccatggt
ctgacaccaatcgtctgtgtcggagagacccttgaagagcgtgaagcaaacaaaacgtct
gacgttgtgacgcttcaggtgaaagaaggcctgaaaggactcacggcagatcaggtcaaa
gagaccgtcgttgcctatgagccgatctgggcgatcggaaccggcaagacagcgacttca
gaagatgccaacgaaacatgcggcgtcatccgtaaagtcattgccggagaattcggtcag
gacgtcgcggatgcggtacgcattcagtacggcggcagcgttaagcctgcgaacattaaa
gagctccttgagcaatctgatatcgatggcgccctggttggcggcgcaagcctggaagcg
gaatcctatcttcagctcgtagaggctggcaatgagtaa

DBGET integrated database retrieval system