KEGG   Bacillus selenitireducens: Bsel_1126Help
Entry
Bsel_1126         CDS       T01243                                 

Definition
putative carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bse  Bacillus selenitireducens
Brite
Enzymes [BR:bse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Bsel_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1300896..1301657
Genome map
AA seq 253 aa AA seqDB search
MVKINRPEPFFFEGGPRAVLLLHGFTGNSADVRMMGRYLNKHGYTCYAPHMSGHGEPPEE
LVKTRAGQWYEDVVDAYRHLQHKGYTDIAVGGLSMGGVMSLKLGMEHPVKGIFPMCAPMF
LNSVEEMHQGVLAFAKEYKELDGIKGEALEREMAAFEGTPIETIKSLNTFIGEVKEEIDL
IYTPTLVVQGVKDDVVGPESAEWIHDHVETDDKKLIWYKESGHVVTLDKEKDQLHEDVHA
FLERLDWTVGHDR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaatcaatcggccggaaccttttttctttgaaggaggaccccgtgcggtcctc
cttctccacgggtttaccgggaactccgcagacgtccgcatgatgggacgctatttaaac
aagcacggctatacctgttacgccccgcatatgagcgggcatggtgagccgccggaagaa
ctcgtaaagacgagagccgggcaatggtatgaagatgttgttgacgcataccggcacctc
cagcataagggctatacggatattgccgtcggcggattgtcgatgggcggggtgatgagt
ctgaagcttggtatggaacatccggtgaaagggattttcccgatgtgcgccccgatgttt
ttgaacagtgttgaagagatgcaccagggagtgctcgccttcgccaaagaatacaaagag
ctcgacggcatcaaaggggaagcccttgaacgggaaatggcggcctttgaaggcacgccg
atcgaaacgatcaagtcgctgaataccttcattggtgaagtcaaagaagagattgatttg
atctataccccgacccttgtggtccagggcgtcaaagatgacgtcgtgggtccggaaagt
gccgaatggatccacgatcatgtggaaaccgacgataaaaaactgatctggtataaagag
tccggccacgtcgtcactctcgacaaggagaaggatcagctgcatgaagatgtacatgcc
ttccttgagcggcttgactggacggttggccacgaccgttaa

DBGET integrated database retrieval system