KEGG   Bacillus selenitireducens: Bsel_1231Help
Entry
Bsel_1231         CDS       T01243                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bse  Bacillus selenitireducens
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bsel_1231
Enzymes [BR:bse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bsel_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1416821..1417651
Genome map
AA seq 276 aa AA seqDB search
MVMMKYETNVERPRGVAVVVHGAGEHHGRYRWLIEQFQAAGFHVVSGDLPGQGKTDGKRG
HIKSFDEYIARITSWLIAAKTYKLPVILFGHSMGGLASVRTVVRLEERLKPDMMILSSPC
LGLVNQTSKPKEFLARVMNRVKPDLYVTSNVRNGTGTRNREVIRLYDEDPLRVRKITVRW
YRELHQSMKAAFTEAASFPDIPLLVSQGGEDLIVDRHEVRKWFDRLPINDKSYKEWPGLY
HEVLNEPERADVYLHLAGFIETQLALLIERDPVTQS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggttatgatgaaatacgagacgaatgtggaaaggccgaggggtgttgccgtggttgtc
cacggggccggcgaacatcacggccgataccggtggctgattgaacagttccaggcagcg
ggctttcatgtagtcagcggtgatctccccggacagggaaagacggacgggaagcgcggg
catatcaagtcctttgatgaatacatagcccggattacttcctggctgattgcggcgaag
acctacaaactgccggttatcctgtttggtcacagcatgggcggtctggcttccgtacgt
accgttgtccgtctagaagagcggctgaagccggatatgatgatcctttcatcaccgtgc
cttggactcgtgaatcagacgagcaagccgaaagagttcctagccagggtgatgaaccgg
gtcaagccggatctgtatgtgacctccaacgtgagaaacggaaccggcactcgtaatcgt
gaggtgatccgtctgtacgatgaagacccgttacgggtcaggaaaatcacggtgaggtgg
tacagagagcttcatcagtccatgaaggctgcctttaccgaagcggcatcgttcccggat
attccgcttttggtctcacagggcggcgaagatttgatcgtggaccggcatgaagtgagg
aagtggtttgaccgtctgccgatcaatgataaatcgtacaaggaatggccgggtctgtac
catgaagtattgaatgaaccggaacgcgcggatgtgtatctgcatctcgcagggtttatt
gaaacgcagctggctcttcttattgagcgggatccggtgacgcagtcatga

DBGET integrated database retrieval system