KEGG   Bacillus selenitireducens: Bsel_1231Help
Entry
Bsel_1231         CDS       T01243                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bse  Bacillus selenitireducens
Pathway
bse00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bsel_1231
Enzymes [BR:bse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bsel_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Thioesterase PGAP1 DUF1057 Abhydrolase_3 Peptidase_S15 LIDHydrolase LCAT DUF1350
Motif
Other DBs
NCBI-ProteinID: ADH98743
JGI: Bsel_1231
UniProt: D6XSF7
Position
1416821..1417651
Genome map
AA seq 276 aa AA seqDB search
MVMMKYETNVERPRGVAVVVHGAGEHHGRYRWLIEQFQAAGFHVVSGDLPGQGKTDGKRG
HIKSFDEYIARITSWLIAAKTYKLPVILFGHSMGGLASVRTVVRLEERLKPDMMILSSPC
LGLVNQTSKPKEFLARVMNRVKPDLYVTSNVRNGTGTRNREVIRLYDEDPLRVRKITVRW
YRELHQSMKAAFTEAASFPDIPLLVSQGGEDLIVDRHEVRKWFDRLPINDKSYKEWPGLY
HEVLNEPERADVYLHLAGFIETQLALLIERDPVTQS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggttatgatgaaatacgagacgaatgtggaaaggccgaggggtgttgccgtggttgtc
cacggggccggcgaacatcacggccgataccggtggctgattgaacagttccaggcagcg
ggctttcatgtagtcagcggtgatctccccggacagggaaagacggacgggaagcgcggg
catatcaagtcctttgatgaatacatagcccggattacttcctggctgattgcggcgaag
acctacaaactgccggttatcctgtttggtcacagcatgggcggtctggcttccgtacgt
accgttgtccgtctagaagagcggctgaagccggatatgatgatcctttcatcaccgtgc
cttggactcgtgaatcagacgagcaagccgaaagagttcctagccagggtgatgaaccgg
gtcaagccggatctgtatgtgacctccaacgtgagaaacggaaccggcactcgtaatcgt
gaggtgatccgtctgtacgatgaagacccgttacgggtcaggaaaatcacggtgaggtgg
tacagagagcttcatcagtccatgaaggctgcctttaccgaagcggcatcgttcccggat
attccgcttttggtctcacagggcggcgaagatttgatcgtggaccggcatgaagtgagg
aagtggtttgaccgtctgccgatcaatgataaatcgtacaaggaatggccgggtctgtac
catgaagtattgaatgaaccggaacgcgcggatgtgtatctgcatctcgcagggtttatt
gaaacgcagctggctcttcttattgagcgggatccggtgacgcagtcatga

DBGET integrated database retrieval system