KEGG   Bacillus selenitireducens: Bsel_1360Help
Entry
Bsel_1360         CDS       T01243                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bse  Bacillus selenitireducens
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bse03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1557159..1558019
Genome map
AA seq 286 aa AA seqDB search
MPELPEVETVRQTLTELLIGRTIEDVWVGWPAMIKEPDDVERFALMLTGQTIQSIGRKGK
FLKLYLDDCVLVSHLRMEGKYALKEAGSERSKHTHVVIRFTDGTALHYADVRKFGTMHAF
VKGTEEQRPPLSKVGPEPVGKDRITADELGTRLKKTTRAVKAALLDQSLVAGLGNIYVDE
ALFRAGIHPAVPAHTLPDKLIPVLLSAISDTLQEAIDQGGTSIRSYVNGKGEMGYFQQQL
FVYGRTGEPCRKCGTPISRSVVGGRGTHTCEVCQPNRVNQKGEKET
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttaccggaagtggaaaccgtccgtcagacgctgacggaacttctgattggg
agaaccatagaagacgtatgggtcggctggcccgcaatgattaaagaacctgacgatgtg
gaacgcttcgcactgatgctgactggacagacgatccagtccatcggacgaaaaggcaag
ttccttaaactgtacctcgatgactgtgtccttgtgtcccatttaaggatggaagggaaa
tatgccctgaaagaggccggttctgagcggtcgaaacatacgcacgttgtgatccgattc
accgacggaacggcccttcactatgcggatgtgaggaagttcgggacgatgcatgccttc
gtaaagggaacggaagaacaaaggcccccgctcagtaaagtggggccggaacccgtcggg
aaagaccggattacagcagacgagctcggaacgagactgaaaaagacgacgcgcgctgtg
aaagcggcgctccttgaccagtctctggtggcggggcttgggaacatctatgtcgatgag
gcgctgtttcgtgccggaatccatcccgctgtaccggcccatactctgccggataagctg
atcccggtgcttctgagcgcgatctcagatacactgcaggaggcaattgatcagggcggc
acatcgatccgctcctacgtgaacggcaaaggtgaaatgggctatttccagcaacagctc
tttgtctatggccggacgggtgaaccttgccggaagtgcggcacacccatcagccgatct
gttgtcggaggacgcggtacccatacatgtgaggtgtgccaaccaaacagagtaaatcaa
aaaggggagaaagaaacatga

DBGET integrated database retrieval system