KEGG   Bacillus selenitireducens: Bsel_1377Help
Entry
Bsel_1377         CDS       T01243                                 

Definition
(GenBank) Cellulase
Organism
bse  Bacillus selenitireducens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1573374..1574453
Genome map
AA seq 359 aa AA seqDB search
MDDMLKMLKELTDANGVPGNEREPRQVMKKYIEPLADEIETDHLGSLIAKKTGSVADGPK
IMVAGHLDEIGFMVTNIDERGFLKFQTVGGWWEQVMLAQRVTVMTKEGDVPGVIGSKPPH
ILPAEARKKSVDKKEMFIDIGATSREEAESFGVRPGDSVVPVCDFTVMKNEKFLMAKAWD
NRIGCAIAIEVLRQLQGVDHPNTVYGVGTVQEEVGLRGARTSAHHIQPDIGFGVDVGIAG
DTPGVTEKDALAKMGKGPQIIMYDASMISHKGLRDFVTGTADEKEIPYQFDSVPGGGTDS
GAIHLTANGVPALSITVATRYIHTHAGILHRDDFENAVKLIVEVIKKLDQDTVKAITFD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggatgatatgttaaagatgctaaaagaactgacggatgccaatggtgtcccgggtaat
gagcgtgagccgcgtcaggtgatgaagaaatacatcgagcctttagcggacgaaatcgaa
accgaccatctggggagtctgatagcaaagaagaccggatccgttgcggatggtccgaaa
atcatggtggcgggtcacctcgatgaaatcggatttatggtgacgaatattgatgagcgc
ggttttttgaagttccagacggttgggggctggtgggaacaagtcatgctcgcccagcgc
gtcacggttatgacaaaagaaggggacgttcccggtgtgatcggctccaaaccccctcat
atcctccctgcagaagcgaggaaaaagtctgtcgacaaaaaggaaatgtttatcgacatc
ggtgccacatcaagggaggaagcggagtctttcggcgtcagaccgggtgattctgtcgtg
cctgtctgtgactttactgttatgaaaaacgagaagttcctcatggcaaaagcgtgggat
aaccgaatcggctgtgcaatcgccatcgaagtgctccgacagctccagggcgtggatcac
ccgaataccgtttatggtgtcggaaccgtgcaggaagaagttggcctccgtggtgcgcgc
acatccgcccaccatatccagccggacattggatttggggttgatgtggggattgccggt
gatacaccgggagtcacagagaaagatgctctggcaaagatggggaaagggccgcaaatc
atcatgtatgatgcgtcaatgatctcccataaagggcttcgagattttgtaacaggaacg
gctgatgaaaaagagattccgtatcagtttgattccgtccctggaggcggtacagattca
ggagcgattcacctgacggcaaacggtgtgccggcactgtcgattaccgttgcaacccgc
tacattcacacacatgcaggcatccttcaccgggatgacttcgagaatgctgttaagctg
attgtcgaagtgattaaaaaactcgatcaggatacggtcaaagccattacatttgactga

DBGET integrated database retrieval system