KEGG   Bacillus selenitireducens: Bsel_1394Help
Entry
Bsel_1394         CDS       T01243                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bse  Bacillus selenitireducens
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bsel_1394
  Lipid metabolism
   00071 Fatty acid degradation
    Bsel_1394
Enzymes [BR:bse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bsel_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1592849..1593631
Genome map
AA seq 260 aa AA seqDB search
MADPSLLALKKDSQIAVVTLTNPPANAISANVIAELDDMFTELQSDDDVKVIILHGEGRF
FAAGADIKEFTELTHANEFRETAREGQRVFRMIETMTKPVIAVIHGAALGGGLELAMACH
MRYVTPNAKLGLPELNLGLIPGFAGTQRLPRMIGHAKALEMMMTAEPITGEEAVSAGLAN
RLVSEEDPLTEVMAMAIKMVTKPRRNLAAVMELVHEAERDSLERGQEKEAVLFGDLAETG
NAREGIRAFMEKRKPTFEDR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccgatccgtcattgctcgctttgaagaaagactcgcaaatagctgttgtcacgctt
accaatccgcctgccaatgccatttcagcaaacgtgatcgcagaactcgatgacatgttc
acggagcttcaatctgatgatgatgtgaaagtgatcattcttcacggtgaagggcgattt
tttgcagcaggagccgatatcaaagaatttacggagctgacacatgctaacgagttcaga
gagactgccagagaagggcagcgcgtattcagaatgatcgagaccatgaccaaaccggtt
attgccgtgatccatggggcggcccttggaggcggactggaactcgccatggcctgtcat
atgcgctacgtcacaccgaatgcgaagcttggactcccagaactgaaccttgggctcatc
ccgggatttgcgggtacgcagagactgccccgaatgatcggacacgccaaggccctcgag
atgatgatgacagcagaaccgattaccggtgaagaagcggtttctgcaggtcttgccaac
agactcgtatcagaggaagatccgttgacggaagtcatggcaatggcgatcaaaatggta
acgaagccgcgccgcaatctggcagccgttatggaacttgttcatgaagcggagcgtgac
tcccttgaacggggacaggagaaagaggctgttctgttcggggatcttgctgaaaccggg
aatgcccgagaaggcatccgggcgttcatggagaagcgtaaacctacgtttgaagaccgc
tga

DBGET integrated database retrieval system