KEGG   Bacillus selenitireducens: Bsel_1422Help
Entry
Bsel_1422         CDS       T01243                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bse  Bacillus selenitireducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bse00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1623497..1624291
Genome map
AA seq 264 aa AA seqDB search
MNGPLSGKRILNTRAPHQQKALTDRLTAWGADVVELPLIRVERVKGVSVREFREAFEAAD
VVVFTSRNAVEVTMDLLKEACQTDDYTRCFEGKVIAAVGEKTGDVLMASGLTPSIMPDVF
EAGHLARSIVDQTAPGAEIFYPRSEKARKTLPKALTEAGRHVTELVIYTTKSQTIPSDKI
TELFEGDGLDVITFMSPTAVQSFFQQMDPALVPDDVRFAVIGEVTERALRPYVKEERLIV
PERYTLEDMIRAIEEFYKRKDDHK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtcctctttccggcaagcggatcctgaacacacgggcgcctcatcaacagaag
gcgctcaccgacagattgacagcctggggagccgacgtggtcgaactccccctcattcgt
gtggaacgtgtgaagggcgtttctgtgagggaattccgagaagcatttgaagcggcggat
gtcgtcgtcttcacgagtcgaaacgcggtcgaggtgacgatggatcttctgaaagaagcc
tgtcagacggacgattatacccggtgttttgaagggaaggtcattgcggccgtcggtgag
aagacgggggacgtgctgatggcgtcaggccttacgccgtcgatcatgcctgacgttttt
gaagcaggccacctggcccgttcgattgtggatcagacagcccctggtgcagagattttc
tatcctagaagcgaaaaagcgagaaaaacattgccaaaagcactgacagaagcagggcgc
catgtgacagagcttgtgatctacaccacgaagtcacagacgattccctctgacaagata
acagagctgtttgaaggtgacggtcttgatgtcatcacctttatgagtccgactgccgtt
cagagcttttttcaacagatggatccggcgctagttcctgatgatgtcagatttgccgtt
atcggagaggtgacggaaagagcgctacgtccttatgtgaaggaggagcggctgattgtc
ccggagcgctacacactcgaagacatgatccgggcaattgaagaattttacaaacggaag
gatgatcataaatga

DBGET integrated database retrieval system