KEGG   Bacillus selenitireducens: Bsel_1569Help
Entry
Bsel_1569         CDS       T01243                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bse  Bacillus selenitireducens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsel_1569
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bsel_1569
   00630 Glyoxylate and dicarboxylate metabolism
    Bsel_1569
Enzymes [BR:bse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bsel_1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1774984..1777161
Genome map
AA seq 725 aa AA seqDB search
MTEDYVTKASLKVDRQFAEWLEHLLKRADLDPESFWEEAALFLNRHHATNDGLLRERNDF
QLMHDQLSSNETDNLDEYRSFLASSGYLEEKRDRVTVQTNNLDDEICRQAGPQLVVPVNN
ERYALNAANARWGSLYDSLYGTDVIPETEGRDKGSSYNPKRGDAVIAYSKGLLDEWVPLE
GASHKEVEGYRINDGVLEGRVNDRWLSLKEKDQFVGYSGDDEKPASILLVHHRMHIDLLF
DEEHPIGKTDPAGMKDIELEGATTVIADFEDSVAAVDAEDKRDVYQKWHELIEGSLTAEF
QKLEKRIIRRLNEDRPYKDKQGNPFQMKGRSLLLVRNVGHLMRTDLIRFEDGSEAYEGMI
DGLVTALIGKLDIEGKGKVQNSLSGSIYIVKPKMHGSKEAAFTNALFTDIEDLLKLERHT
IKVGVMDEERRTSLNLTNCIEEVKDRIFFINTGFLDRTGDEIHTSFKLGPMIRKGDMKHS
AWLTGYERSNVLNGLKTKLHEQGQIGKGMWAMPDEMKQMVDQKIGHLHAGGNTAWVPSPT
AAVLHAIHYHQADIDSIQASLLESLEEQTNEMLTIPIEKKPAWTEDEIREELENNAQGIL
GYVVRWVEHGVGCSKVPDIHGTGLMEDRATLRISSQHMANWLYHGIVTEEQIKNVMKKMA
KLVDRQNEADPDYKPMNGRYEESEAFQAALELVLKGQDQPSGYTEPILHRRRKQYKQKQS
QGVKM
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaagactatgtaacaaaagcatcgctgaaagtggaccgccaatttgctgaatgg
ctggaacacttactaaaaagagcagatttggacccggaatcattttgggaagaggcggct
ctcttcctaaacaggcaccatgccacgaatgatggattactcagagaaagaaacgatttt
caacttatgcacgatcaattgtcctccaatgagacggataaccttgatgagtaccgctca
tttttagcatcatccggctatcttgaggaaaaacgtgaccgcgtgaccgtccagacgaat
aatctcgatgacgaaatttgccgacaggcgggtccgcagttagtcgtaccggtgaacaat
gaacgctatgcactgaatgcagcaaatgcgagatggggaagtttatatgactccctctat
ggaacagacgtcatcccggagactgaggggcgtgacaaaggatcttcctacaacccgaaa
cgcggagatgccgtcattgcttacagcaaaggactgcttgatgaatgggtaccgctcgaa
ggtgccagtcacaaggaagtggaaggctaccgaatcaatgacggggtattagaaggcagg
gtgaatgaccgctggttatctcttaaagagaaggatcagttcgtcggatacagcggtgat
gacgagaagcccgcatccatcttgcttgttcatcaccgcatgcatattgatttattattc
gatgaggaacatccgatcggaaagacagatcctgctggaatgaaagatattgaactcgaa
ggagcaacaacggtcattgcggattttgaagattctgttgctgcggtggacgcggaggat
aagcgggatgtctatcaaaaatggcacgaactgattgaaggctcactcactgcggaattt
caaaagttggagaaacggattatccgaagattgaatgaggaccgcccctataaagacaaa
caggggaacccgttccaaatgaaagggcgatcactcctcctggtccggaatgtcgggcat
ttgatgagaacagatctgattcgctttgaagatgggtctgaggcttatgagggcatgatt
gacggactggtgaccgctctgattggtaaacttgatattgaagggaaagggaaggttcaa
aattccctcagcggctcgatctatatcgtaaaaccaaaaatgcatggatcaaaagaggca
gcgttcacgaatgcgcttttcacagatattgaagatctgttaaagcttgaacggcatacc
atcaaagtcggggtgatggatgaagaacggcgaacgagcctcaacctgacaaactgcatc
gaggaagtgaaagaccggatcttttttatcaacaccggttttctcgaccgaacgggagat
gagattcatacttctttcaaactcgggcccatgatccgaaaaggcgatatgaaacattct
gcatggctgaccgggtatgaacggtcgaacgtgcttaacggactcaagacgaaacttcat
gaacaaggacagattggtaaaggcatgtgggcgatgcccgatgagatgaagcagatggtg
gatcagaaaatcggtcatttgcatgcgggtggaaacactgcctgggtaccgtcccctacc
gctgctgtcttacatgccatacactatcatcaggcagacattgactcgattcaagcttcg
ctccttgaatctttggaagaacagacaaatgagatgctgacgataccgattgagaaaaag
cctgcatggacagaagacgagatccgggaagaattggagaacaatgcccaggggattctc
ggctatgtggtgagatgggtggaacatggtgtcggctgttctaaagtgccggatattcac
ggtacagggttgatggaggaccgtgcgacgctcagaatctccagccagcatatggcgaac
tggctttatcacggaattgtgacggaagaacagattaaaaacgtgatgaagaagatggcg
aaactggttgatcgtcaaaatgaggcggatcctgactacaagccgatgaacggcaggtat
gaggagtcagaagcgttccaggctgcactcgaactcgtcttgaaagggcaggatcagccg
agcggctatacagaaccgattttgcaccgaagaaggaagcagtataaacaaaaacaatca
cagggagtgaagatgtaa

DBGET integrated database retrieval system