KEGG   Bacillus selenitireducens: Bsel_1569Help
Entry
Bsel_1569         CDS       T01243                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bse  Bacillus selenitireducens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsel_1569
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bsel_1569
   00630 Glyoxylate and dicarboxylate metabolism
    Bsel_1569
Enzymes [BR:bse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bsel_1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1774984..1777161
Genome map
AA seq 725 aa AA seqDB search
MTEDYVTKASLKVDRQFAEWLEHLLKRADLDPESFWEEAALFLNRHHATNDGLLRERNDF
QLMHDQLSSNETDNLDEYRSFLASSGYLEEKRDRVTVQTNNLDDEICRQAGPQLVVPVNN
ERYALNAANARWGSLYDSLYGTDVIPETEGRDKGSSYNPKRGDAVIAYSKGLLDEWVPLE
GASHKEVEGYRINDGVLEGRVNDRWLSLKEKDQFVGYSGDDEKPASILLVHHRMHIDLLF
DEEHPIGKTDPAGMKDIELEGATTVIADFEDSVAAVDAEDKRDVYQKWHELIEGSLTAEF
QKLEKRIIRRLNEDRPYKDKQGNPFQMKGRSLLLVRNVGHLMRTDLIRFEDGSEAYEGMI
DGLVTALIGKLDIEGKGKVQNSLSGSIYIVKPKMHGSKEAAFTNALFTDIEDLLKLERHT
IKVGVMDEERRTSLNLTNCIEEVKDRIFFINTGFLDRTGDEIHTSFKLGPMIRKGDMKHS
AWLTGYERSNVLNGLKTKLHEQGQIGKGMWAMPDEMKQMVDQKIGHLHAGGNTAWVPSPT
AAVLHAIHYHQADIDSIQASLLESLEEQTNEMLTIPIEKKPAWTEDEIREELENNAQGIL
GYVVRWVEHGVGCSKVPDIHGTGLMEDRATLRISSQHMANWLYHGIVTEEQIKNVMKKMA
KLVDRQNEADPDYKPMNGRYEESEAFQAALELVLKGQDQPSGYTEPILHRRRKQYKQKQS
QGVKM
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaagactatgtaacaaaagcatcgctgaaagtggaccgccaatttgctgaatgg
ctggaacacttactaaaaagagcagatttggacccggaatcattttgggaagaggcggct
ctcttcctaaacaggcaccatgccacgaatgatggattactcagagaaagaaacgatttt
caacttatgcacgatcaattgtcctccaatgagacggataaccttgatgagtaccgctca
tttttagcatcatccggctatcttgaggaaaaacgtgaccgcgtgaccgtccagacgaat
aatctcgatgacgaaatttgccgacaggcgggtccgcagttagtcgtaccggtgaacaat
gaacgctatgcactgaatgcagcaaatgcgagatggggaagtttatatgactccctctat
ggaacagacgtcatcccggagactgaggggcgtgacaaaggatcttcctacaacccgaaa
cgcggagatgccgtcattgcttacagcaaaggactgcttgatgaatgggtaccgctcgaa
ggtgccagtcacaaggaagtggaaggctaccgaatcaatgacggggtattagaaggcagg
gtgaatgaccgctggttatctcttaaagagaaggatcagttcgtcggatacagcggtgat
gacgagaagcccgcatccatcttgcttgttcatcaccgcatgcatattgatttattattc
gatgaggaacatccgatcggaaagacagatcctgctggaatgaaagatattgaactcgaa
ggagcaacaacggtcattgcggattttgaagattctgttgctgcggtggacgcggaggat
aagcgggatgtctatcaaaaatggcacgaactgattgaaggctcactcactgcggaattt
caaaagttggagaaacggattatccgaagattgaatgaggaccgcccctataaagacaaa
caggggaacccgttccaaatgaaagggcgatcactcctcctggtccggaatgtcgggcat
ttgatgagaacagatctgattcgctttgaagatgggtctgaggcttatgagggcatgatt
gacggactggtgaccgctctgattggtaaacttgatattgaagggaaagggaaggttcaa
aattccctcagcggctcgatctatatcgtaaaaccaaaaatgcatggatcaaaagaggca
gcgttcacgaatgcgcttttcacagatattgaagatctgttaaagcttgaacggcatacc
atcaaagtcggggtgatggatgaagaacggcgaacgagcctcaacctgacaaactgcatc
gaggaagtgaaagaccggatcttttttatcaacaccggttttctcgaccgaacgggagat
gagattcatacttctttcaaactcgggcccatgatccgaaaaggcgatatgaaacattct
gcatggctgaccgggtatgaacggtcgaacgtgcttaacggactcaagacgaaacttcat
gaacaaggacagattggtaaaggcatgtgggcgatgcccgatgagatgaagcagatggtg
gatcagaaaatcggtcatttgcatgcgggtggaaacactgcctgggtaccgtcccctacc
gctgctgtcttacatgccatacactatcatcaggcagacattgactcgattcaagcttcg
ctccttgaatctttggaagaacagacaaatgagatgctgacgataccgattgagaaaaag
cctgcatggacagaagacgagatccgggaagaattggagaacaatgcccaggggattctc
ggctatgtggtgagatgggtggaacatggtgtcggctgttctaaagtgccggatattcac
ggtacagggttgatggaggaccgtgcgacgctcagaatctccagccagcatatggcgaac
tggctttatcacggaattgtgacggaagaacagattaaaaacgtgatgaagaagatggcg
aaactggttgatcgtcaaaatgaggcggatcctgactacaagccgatgaacggcaggtat
gaggagtcagaagcgttccaggctgcactcgaactcgtcttgaaagggcaggatcagccg
agcggctatacagaaccgattttgcaccgaagaaggaagcagtataaacaaaaacaatca
cagggagtgaagatgtaa

DBGET integrated database retrieval system