KEGG   Bacillus selenitireducens: Bsel_1570Help
Entry
Bsel_1570         CDS       T01243                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bse  Bacillus selenitireducens
Pathway
bse00630  Glyoxylate and dicarboxylate metabolism
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01120  Microbial metabolism in diverse environments
bse01200  Carbon metabolism
Module
bse_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bsel_1570
Enzymes [BR:bse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bsel_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Glyco_hydro_25
Motif
Other DBs
NCBI-ProteinID: ADH99081
JGI: Bsel_1570
UniProt: D6XTE5
Position
1777161..1778444
Genome map
AA seq 427 aa AA seqDB search
MGQKTTKMMLNEWKTDRFKGVERPYTPEDVQKLQGSLHIEHSIARYGADKLWKLMEERPY
VKALGALTGNQAMQQVKAGLEAIYLSGWQVAADANLSGQMYPDQSLYPANSVPNVVKKIN
QTFQRADQIQQSEGGGEIDYFAPIVADMEAGFGGPLNVFELTKSMIESGAAGVHLEDQLS
SEKKCGHLGGKVLQPTQVAVRNLISARLAADVCDVPTIIVARTDANAADLLTSDVDPYDH
EFLTGERTSEGFYRTKAGIEQAISRGLAYAPYADLVWCETSEPNLEEARMFAEAIHEKYP
DKKLAYNCSPSFNWKKKLDQETIAKFQDELGQMGYAFQFVTLAGFHALNHSMFELALDYK
SRGMAAYSELQQAEFDSEKDGYTATRHQREVGTGYFDEVSQVISGGTSSTLALRGSTESD
QFTKSHA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaaaaacaacgaaaatgatgctgaatgaatggaaaacagaccggtttaaaggt
gttgaacgtccatatacaccggaggacgtgcaaaagctgcagggttctcttcatatcgag
cacagcattgcaagatacggagcagataaactctggaagctgatggaagagcgtccatac
gtcaaggctcttggcgccttgacaggtaatcaggctatgcagcaggtcaaagccggactt
gaagccatttacctcagcggttggcaggttgcagctgatgcgaatctgtctggacagatg
tacccggatcagagcctctacccggcgaactcggtaccaaacgtcgtgaagaagatcaat
cagacgttccagcgtgccgatcagatccaacagtctgaaggcggaggtgaaatcgattac
tttgcaccgattgttgcggatatggaagcaggctttggcggaccattgaatgtgtttgaa
ctgacgaaatcgatgatcgaatccggtgctgccggtgtacacctcgaagatcagctttct
tcagagaaaaaatgcggccatttgggcggtaaagttctccagcctacacaggttgcggta
aggaacctgatatctgcaagactcgctgcagatgtatgtgatgtaccgacaatcattgtg
gcaagaacagatgccaatgctgccgatcttctgacgagtgatgtggacccgtatgatcat
gagttcctcacgggggaacggacgtctgaaggattctaccggacgaaagcggggattgaa
caggccatctccagagggctcgcttatgcgccttatgcagatctggtctggtgcgagacg
agtgagccgaatcttgaggaagcgcgcatgtttgctgaggcaatccacgagaaatatccg
gataagaaactggcctataactgctcaccatcttttaactggaagaaaaaattggatcag
gagaccattgcaaaattccaggacgaactgggtcaaatgggttatgcgttccagtttgtt
acccttgccggtttccatgctctgaaccacagtatgttcgaactggcactggattataaa
tcacgggggatggccgcatactcagaactccagcaggctgagtttgattcagaaaaagac
ggctacacggcaacacgccatcagcgtgaagtcgggacaggctattttgatgaagtctca
caggttatttcaggggggacatcctcgacattggctctcagagggtcaacggaaagcgat
cagtttacgaaatcacatgcttaa

DBGET integrated database retrieval system