KEGG   Bacillus selenitireducens: Bsel_1604Help
Entry
Bsel_1604         CDS       T01243                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bse  Bacillus selenitireducens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsel_1604
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_1604
   00020 Citrate cycle (TCA cycle)
    Bsel_1604
   00620 Pyruvate metabolism
    Bsel_1604
Enzymes [BR:bse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bsel_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1807305..1808933
Genome map
AA seq 542 aa AA seqDB search
MAYEFKLPDIGEGIHEGEIAKWNVKEGDEIKEDDVLCEVQNDKAVVEIPSPVDGKIAKIH
VEEGVVTEVGTVIVSFETDAEQPEDAHGKEEEQEEASSSETESTSTSSKSSGYEFKLPDI
GEGIHEGEVAKWNVKEGDEVKEDDVLCEVQNDKAVVEIPSPVDGTVKKIHVEEGVVINVG
DVIITFDTDAEQPEDAHGSSGEEAPKTDDKAPKSTAKSSEPLDENRRVIAMPSVRKFARE
KDVDIRQVRGSGKNGRVLKEDIETFVNGDQAAAEETDAAATQASKSSEPAKEEQKKEKQS
VPAYQPANAELETREKMSGIRRAISKAMVNSKHTAPHVTLMDEIDVTDLVAHRKQFKQAA
QDKGIKLTYLPYVVKALTSAIREYPILNASVDDSTDEIVYKHYFNIGIAADTEKGLLVPV
VKDTERKSIFSISDEINQLADKARNGSLSSDEMKGGSTTITNIGSAGGQWFNPVINHPEV
AILGLGRIAEKPIVKEGEIVIAPVLALSLSFDHRVIDGATAQHAMNHIKRLLNDPQLLMM
EG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgaatttaaactccctgatatcggagaagggatccacgaaggtgaaatcgcc
aagtggaacgtaaaagaaggcgatgaaatcaaagaagatgacgtgctttgtgaagtgcag
aatgacaaagcagtagtggaaatcccatcacctgttgacggaaaaattgcaaaaatacat
gtagaagaaggtgtcgtaaccgaagtcgggacagtcattgtttccttcgagacagatgcg
gaacagcctgaggatgcacacggcaaagaagaagagcaggaagaagcatcatcttctgaa
acagaatccacttcaacctcttccaaatcttcaggatatgagtttaaacttcctgatatt
ggtgaaggtatacatgaaggtgaagttgcgaaatggaatgtaaaagaaggcgacgaggtg
aaggaagacgacgtcctttgcgaagtgcaaaatgataaggctgtagtggaaattccgtca
ccggttgacggtaccgtaaagaaaatacatgtagaagaaggcgtcgtcatcaatgtcggt
gatgttattattacctttgatacagatgcggaacagcctgaagatgctcacggcagttct
ggtgaagaagcgccgaagacagacgataaagctccaaaatcaactgccaagtcttctgaa
cctttggatgagaaccggcgcgtgattgcgatgccgtccgttcggaaatttgcccgggaa
aaagatgtcgatatccgtcaagtgcgagggtccggaaaaaatggccgcgtattgaaggag
gacatcgaaacctttgtcaatggtgaccaggcagcagctgaagaaacagacgcagctgcc
actcaggcatcaaaaagcagcgaaccggcaaaagaagaacagaaaaaagaaaaacagtcc
gttccagcttatcagcctgcaaatgcagaacttgaaacaagagaaaagatgtcaggcatt
cgccgtgcaatttcaaaagccatggtcaattccaagcacactgctccgcatgtgacgctg
atggatgaaattgatgtaactgatctggtagcgcaccgtaaacagtttaagcaggccgca
caagacaagggtatcaaattaacctatctgccatacgtagtaaaagcactcacatctgcg
atccgcgaatatccaatcctgaatgcatctgtggatgattcaacggatgaaattgtatat
aagcattactttaatatcggtatcgcggcagatacagaaaaaggccttcttgtaccggtt
gtgaaagacacagaacgtaagtccattttcagtatttctgatgagatcaaccagcttgcg
gataaagcacgcaatggcagtctctcttcagatgaaatgaaaggcggttccacaacgatt
accaatatcggttctgccggtggacagtggttcaacccggttatcaaccatcctgaagtc
gcgattctcggtctcggacgcattgctgaaaaaccgattgtcaaagaaggtgaaattgtt
atcgcaccagtccttgctctgtcactgagtttcgatcaccgtgttattgacggtgcgaca
gcgcagcacgccatgaaccacattaagcggttactgaacgatccacaattactcatgatg
gagggataa

DBGET integrated database retrieval system