KEGG   Bacillus selenitireducens: Bsel_1650Help
Entry
Bsel_1650         CDS       T01243                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bse  Bacillus selenitireducens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bse00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bse00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1845645..1847114
Genome map
AA seq 489 aa AA seqDB search
MMKIRELLDHISPCRVKGDLDQDIKSLEMDSRLVSEGALFFCIRGFTVDGHDYAAQAADR
GAVAFLTEEELPVDGTQLIVRDSRRAMAQLAARFYNYPSDRMTMIGVTGTNGKTSVTHFI
QDLLKRAGTEAGMIGTMYTELKGIQTETVNTTPESFTLQKRLNEMYLAGAEAVTMEVSSH
ALHLGRVHGTAFDVAVFTNLSQDHLDYHQTMDQYAQAKSLLFSQLGSGGETDAYKRAVIN
VDDSYADIMLGASAVPVITYGIEKPCDVRAEDLEVSPEGIRFTIRLNQQSYPVQLKLAGT
FSVYNALAAFAAVYAIGIEPEQAARFLSELPQVRGRFERVETDAPFHVIVDYAHTPDGLE
NVIRTAKETTDRPVTVVFGCGGDRDRKKRPLMGKLAEDLADHVILTSDNPRSENPEAIIQ
DILSGMSKDNHTVQTDRKAAITHAIMNATEGEVIVIAGKGHETYQITGDVTLDFDDRKVS
LEAVKERYS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatcagagaacttttagatcatatcagtccatgccgtgtcaaaggcgatttg
gatcaggatatcaagagtctggaaatggattcaagacttgtctcagaaggtgcattgttt
ttctgtattcggggatttactgtagatggccatgattatgcagctcaggcagctgatcgt
ggtgcggttgcattccttacggaagaggagcttcctgtggatggtacacagctcattgta
agggactcaagacgggccatggctcagctggcggcccgtttttacaactacccgtctgat
cggatgactatgatcggggtgacaggaacgaatggaaaaacgagtgtcacgcattttatt
caggatttgctgaaacgcgcaggcacagaagccggcatgataggtacaatgtatacagaa
ctgaaaggcattcagacggaaacggtcaatacaactccggagtcttttacactgcaaaag
cggttgaacgagatgtaccttgcaggagctgaagcggtgacaatggaagtttcgtctcat
gcccttcatttgggaagggtgcacggaacggcatttgatgttgcggtctttacaaatctc
agccaggaccacctggattatcatcaaacgatggatcagtacgcgcaggcaaagagcctg
ttattttctcaacttggttcgggtggtgaaaccgacgcctataagcgggctgtgatcaat
gtcgacgatagctatgcggatatcatgctgggtgcttcggctgtgcctgtcataacgtat
gggattgaaaaaccttgcgatgtcagggcggaagatttagaagtcagtccggagggcatc
cgattcacgatccgtctgaatcagcagtcttatccggtccagctgaaacttgcaggcaca
ttctccgtttacaatgctcttgctgcctttgcggcagtatatgcaatcggaatcgaaccg
gagcaggcggcccgctttctttcggaactgcctcaggtccgggggcgctttgaacgggtg
gaaacggatgcgccttttcacgtcattgtcgattatgcacacacgcctgacggactcgaa
aatgtgatccggacagcgaaggagacgactgacagaccggtaactgtggtctttggatgt
ggaggagaccgggaccggaagaagcgtccgctaatggggaaactggccgaagatttggca
gaccacgtcattttaacctcggataatccgagatcagaaaatcctgaagcgattattcag
gatatcctgtccggtatgagtaaagataatcatacggtccaaaccgatcgtaaagcagca
atcacccatgcgataatgaatgcaacagaaggagaggtcattgttattgcaggtaagggg
catgaaacctaccagattacaggtgatgtgacccttgattttgatgatagaaaggtgtct
ttagaagctgtaaaggagagatactcatga

DBGET integrated database retrieval system