KEGG   Bacillus selenitireducens: Bsel_1650Help
Entry
Bsel_1650         CDS       T01243                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bse  Bacillus selenitireducens
Pathway
bse00300  Lysine biosynthesis
bse00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bsel_1650
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bsel_1650
Enzymes [BR:bse01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Bsel_1650
Peptidoglycan biosynthesis and degradation proteins [BR:bse01011]
 Precursor biosynthesis
  Amino acid ligase
   Bsel_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase RraA-like LpxD
Motif
Other DBs
NCBI-ProteinID: ADH99159
JGI: Bsel_1650
UniProt: D6XTM3
Position
1845645..1847114
Genome map
AA seq 489 aa AA seqDB search
MMKIRELLDHISPCRVKGDLDQDIKSLEMDSRLVSEGALFFCIRGFTVDGHDYAAQAADR
GAVAFLTEEELPVDGTQLIVRDSRRAMAQLAARFYNYPSDRMTMIGVTGTNGKTSVTHFI
QDLLKRAGTEAGMIGTMYTELKGIQTETVNTTPESFTLQKRLNEMYLAGAEAVTMEVSSH
ALHLGRVHGTAFDVAVFTNLSQDHLDYHQTMDQYAQAKSLLFSQLGSGGETDAYKRAVIN
VDDSYADIMLGASAVPVITYGIEKPCDVRAEDLEVSPEGIRFTIRLNQQSYPVQLKLAGT
FSVYNALAAFAAVYAIGIEPEQAARFLSELPQVRGRFERVETDAPFHVIVDYAHTPDGLE
NVIRTAKETTDRPVTVVFGCGGDRDRKKRPLMGKLAEDLADHVILTSDNPRSENPEAIIQ
DILSGMSKDNHTVQTDRKAAITHAIMNATEGEVIVIAGKGHETYQITGDVTLDFDDRKVS
LEAVKERYS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatcagagaacttttagatcatatcagtccatgccgtgtcaaaggcgatttg
gatcaggatatcaagagtctggaaatggattcaagacttgtctcagaaggtgcattgttt
ttctgtattcggggatttactgtagatggccatgattatgcagctcaggcagctgatcgt
ggtgcggttgcattccttacggaagaggagcttcctgtggatggtacacagctcattgta
agggactcaagacgggccatggctcagctggcggcccgtttttacaactacccgtctgat
cggatgactatgatcggggtgacaggaacgaatggaaaaacgagtgtcacgcattttatt
caggatttgctgaaacgcgcaggcacagaagccggcatgataggtacaatgtatacagaa
ctgaaaggcattcagacggaaacggtcaatacaactccggagtcttttacactgcaaaag
cggttgaacgagatgtaccttgcaggagctgaagcggtgacaatggaagtttcgtctcat
gcccttcatttgggaagggtgcacggaacggcatttgatgttgcggtctttacaaatctc
agccaggaccacctggattatcatcaaacgatggatcagtacgcgcaggcaaagagcctg
ttattttctcaacttggttcgggtggtgaaaccgacgcctataagcgggctgtgatcaat
gtcgacgatagctatgcggatatcatgctgggtgcttcggctgtgcctgtcataacgtat
gggattgaaaaaccttgcgatgtcagggcggaagatttagaagtcagtccggagggcatc
cgattcacgatccgtctgaatcagcagtcttatccggtccagctgaaacttgcaggcaca
ttctccgtttacaatgctcttgctgcctttgcggcagtatatgcaatcggaatcgaaccg
gagcaggcggcccgctttctttcggaactgcctcaggtccgggggcgctttgaacgggtg
gaaacggatgcgccttttcacgtcattgtcgattatgcacacacgcctgacggactcgaa
aatgtgatccggacagcgaaggagacgactgacagaccggtaactgtggtctttggatgt
ggaggagaccgggaccggaagaagcgtccgctaatggggaaactggccgaagatttggca
gaccacgtcattttaacctcggataatccgagatcagaaaatcctgaagcgattattcag
gatatcctgtccggtatgagtaaagataatcatacggtccaaaccgatcgtaaagcagca
atcacccatgcgataatgaatgcaacagaaggagaggtcattgttattgcaggtaagggg
catgaaacctaccagattacaggtgatgtgacccttgattttgatgatagaaaggtgtct
ttagaagctgtaaaggagagatactcatga

DBGET integrated database retrieval system