KEGG   Bacillus selenitireducens: Bsel_1673Help
Entry
Bsel_1673         CDS       T01243                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bse  Bacillus selenitireducens
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bse00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bse00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1867991..1868893
Genome map
AA seq 300 aa AA seqDB search
MSSLTSLKMLSVEEIDRILDDAERLYEVRHVGSRNGHVIANLFFEASTRTKCSFEMAQKQ
LGIDTLHFDVATSSVNKGEGLYDTAKTLESIGCDAFIIRHGETRYYEQLKGLTVPIINAG
DGSGDHPTQSLLDLLTIRQEFGLFRGLKVVIVGDILHSRVAHSNIEVLERFGAEVYVSGP
EEWIDEDIPREKRLTIDEAVEIADVVMLLRIQLERHDGEMLSNPDDYLQTYGLTMEREKR
MKPHGIIMHPAPVNRGVEIDSSLVECERSRIFKQMNNGVAVRKAVLVRALHQKEAPVHVV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcattaacctctttaaagatgctttctgtagaagaaattgacaggattctcgat
gatgcggaacgattatatgaagtgcggcacgtagggagccggaacggacatgtgattgcc
aatttattttttgaggcaagcacccgtacgaaatgcagttttgagatggcacagaaacag
ctggggatcgatacgcttcattttgatgtcgccacgtcaagcgtcaataaaggagagggc
ctttacgatacagcgaaaaccctcgagtccataggctgtgatgcttttattatccgtcac
ggagaaacacgctattatgaacagctgaaaggattgacggttccaatcatcaatgcagga
gacggttcgggggatcatccgactcagtcactgctcgatcttctcaccatccgtcaggaa
tttggcctcttcagggggctgaaagtcgtcattgtcggggatattctccacagcagggtc
gcacattccaatattgaagttcttgagcgatttggcgcggaggtctatgtgagcggacct
gaagaatggattgatgaggatatcccgcgcgagaaacggctcacgattgacgaggccgtc
gaaatcgcagatgtagtgatgcttctccggattcagcttgaacgtcacgatggagagatg
ctgtccaatccggatgactatctgcagacatacgggttaacgatggaaagagagaaaagg
atgaagccgcacggaatcattatgcaccctgctccggtgaaccgtggtgtggagattgat
tcttctcttgtggaatgtgaacggtcaagaatctttaaacagatgaacaacggtgtagcc
gtaagaaaagccgtactcgttcgggcattgcatcaaaaggaggctcctgtacatgtggta
taa

DBGET integrated database retrieval system