KEGG   Bacillus selenitireducens: Bsel_1688Help
Entry
Bsel_1688         CDS       T01243                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bse  Bacillus selenitireducens
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bsel_1688
Enzymes [BR:bse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bsel_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1886464..1887075
Genome map
AA seq 203 aa AA seqDB search
MKREKGLLIVLSGPSGVGKGTVCGALREHDTHIRYSVSATTRSPREGEQEGVNYFYKSKE
EFERMIHEDELLEYAQYVENYYGTPRQYVEEMINKGHDVILEIEVQGALQVKETFPEGVF
IFLMPPDLKELRNRIEGRGTETKELIDNRMSVAKDEIDLMDKYDYVVENDEVELAVERIK
AIVTAENCKKDRLIHLYKELVKE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagaaaagggtttactgatcgtgctgtccggtccttccggggtcggaaaagga
acggtttgcggggcactccgtgaacatgatacacatattcgctactcggtttcagcgacg
acccgctcgccgcgggaaggggaacaggagggcgttaattatttttacaagtcgaaagaa
gagttcgaacgtatgatccatgaggatgaactgcttgaatacgctcagtacgttgagaat
tattatggcacaccgagacaatacgtcgaagagatgattaataaaggtcacgatgtcatc
ctcgaaatcgaggtgcagggtgctcttcaagttaaagaaacctttccggagggcgtgttt
attttcctgatgccacctgacctgaaagaacttcgaaaccgtattgaaggccgcgggacg
gaaacgaaggaactgattgataaccgcatgagtgtggcaaaagacgagatcgatctgatg
gacaagtatgattacgttgttgaaaacgatgaagtggaacttgccgttgagcgaatcaaa
gccattgtaaccgcagaaaactgcaaaaaggaccgtctgatccatctgtataaagaactt
gtaaaggagtga

DBGET integrated database retrieval system