KEGG   Bacillus selenitireducens: Bsel_1730Help
Entry
Bsel_1730         CDS       T01243                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bse  Bacillus selenitireducens
Pathway
bse00020  Citrate cycle (TCA cycle)
bse00640  Propanoate metabolism
bse00660  C5-Branched dibasic acid metabolism
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01120  Microbial metabolism in diverse environments
bse01130  Biosynthesis of antibiotics
bse01200  Carbon metabolism
Module
bse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bsel_1730
   00640 Propanoate metabolism
    Bsel_1730
   00660 C5-Branched dibasic acid metabolism
    Bsel_1730
Enzymes [BR:bse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bsel_1730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADH99238
JGI: Bsel_1730
UniProt: D6XTV2
Position
1926234..1927397
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQGKELLRKYGVAVPNGKVAYSVDEAVKAAEELGTDISVVKAQIHAGGRGKAGGV
KVAKSLDEVRTYADEILGKVLVTHQTGPEGKEVKRLLIEEGCDIQNEYYVGIVVDRATSR
ITMMASEEGGTEIEEVAAETPEKIFKEIIDPVTGLMPYQARRLAFNINIPKEMLKEAVKF
MMGLYKVFEEKDCSIAEINPLVTTGDGSVMALDAKLNFDSNALFRQKDIVEFRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIYVNIFGGIMKCDIIADGVVAATKEVGLEIPLVVRLEGTNVELGKKI
LKESGLNITAADSMADGAQKIVSLVKA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaagggaaagagcttctaagaaagtatggagtagctgttccg
aatgggaaagtggcctactcggtcgacgaagctgtcaaagctgctgaggagctcggcact
gacatcagcgtcgtcaaagcccagatccatgcgggaggaagaggtaaagccggaggggtg
aaagtggcgaaatccctcgatgaagtgcgtacatatgctgatgagattctcggtaaagtt
cttgtgacgcaccagacaggtcctgaagggaaagaagtcaagcgtcttctgattgaagaa
ggctgtgatattcagaatgaatattacgtcgggattgtagtggaccgtgccacgtcacgg
ataaccatgatggcatctgaggaaggcggtacagaaattgaggaagtggccgctgagacg
ccggagaagatcttcaaggaaattattgatccggtcacaggactcatgccttaccaggca
aggagactggcgtttaatattaatatcccgaaagagatgcttaaagaggccgttaaattt
atgatgggtctctataaagtctttgaagaaaaagactgttccattgctgagatcaatcca
ctcgtgacgacgggagacggaagcgtcatggcactcgatgccaagctgaattttgactcg
aatgccctgttccgtcaaaaagacatcgtggaattccgtgatctcgatgaagaggatccg
aaagaaatcgaggcatcaaaatacgatctcagctatatttccctcgatggcaatatcggc
tgtatggttaatggtgcgggtctggctatggcgacgatggatatcatcaagcattatcac
ggtgatccggcgaacttcctcgacgtcgggggcggtgcaacggcggaaaaggtaacggaa
gcttttaagattatcctgtccgatcagaatgtcaaagggatttatgtcaatatctttggc
gggatcatgaagtgtgacattattgccgacggtgttgttgcggcaacgaaggaagtcggt
ctggagattccgctggtcgtaagacttgagggaaccaatgtggaactcggaaagaaaatt
ctgaaggaatccggattgaatataacagcagccgattccatggctgatggtgcacaaaaa
atcgtatcgcttgtgaaagcgtaa

DBGET integrated database retrieval system