KEGG   Bacillus selenitireducens: Bsel_1900Help
Entry
Bsel_1900         CDS       T01243                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
bse  Bacillus selenitireducens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsel_1900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_1900
   00020 Citrate cycle (TCA cycle)
    Bsel_1900
   00620 Pyruvate metabolism
    Bsel_1900
   00640 Propanoate metabolism
    Bsel_1900
   00650 Butanoate metabolism
    Bsel_1900
  Energy metabolism
   00680 Methane metabolism
    Bsel_1900
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Bsel_1900
Enzymes [BR:bse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Bsel_1900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2105788..2106801)
Genome map
AA seq 337 aa AA seqDB search
MSILPKKNELGFFEIRLESIGGLGANLAGKMLAEAGVQGLGLNGANFSSYGSEKKGSPVK
SFVRFCESDVEIRDHAPIEQPHVIGVFHEALYKMVDVVSGLTADGVVLVNTQSDFDTIRN
DLKVEYGTIAAVDALKIANEEKTKVNTAMLGALYRILDFLDPDYMRNVIRKTFEKKYPHL
VEPNIRTFDRGYNEVTFKKYEAPADAESREFTRVQPRLGYETQVMGGIITAQANSIQKDL
SGSRIGFLPEYKEESCIHCAACDTVCPDYCFVWEQGEDKKGRPQMFLKGIDYQYCKGCLK
CVDACPTDALADLVEEKGYAEDNQVKHNFPYVAGGMK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctattttaccaaaaaagaacgagcttggcttttttgagatccgactggaatccatc
ggcggacttggagccaaccttgcaggaaagatgctagctgaagcaggggttcagggattg
ggcctgaacggagccaacttctcctcttatggatcagagaagaaaggatctcctgttaaa
tcatttgtccggttttgtgaatcagatgttgaaattcgtgaccatgcaccaattgaacag
cctcatgttattggtgtattccatgaagcactttataaaatggtcgatgtcgtaagcggt
ttaacagcggacggggtagtccttgttaacacacagagcgattttgatacaatccgaaat
gatctgaaagtggaatatggcacgattgctgccgtcgatgctttaaaaatagccaatgaa
gaaaagacaaaagttaatacggcaatgctcggcgctctctatcgtatccttgatttcctg
gatcctgactatatgcgaaatgtcattcgcaaaacgtttgaaaagaaatacccacacctc
gttgaaccgaatatccgcacatttgaccgtggatacaatgaagtgacgtttaagaaatac
gaagcacctgccgatgcagagagcagagagtttacccgtgttcagccgcgactcggttat
gaaacacaggtgatgggtgggattatcaccgctcaggccaacagcattcaaaaagattta
agcggttcgcgtatcggctttctgcctgaatacaaagaagaatcctgtattcactgtgcc
gcctgtgacacagtctgcccggattattgctttgtctgggaacagggcgaagacaaaaaa
ggacgtccgcaaatgttccttaagggaattgattatcaatactgcaaaggctgtctgaaa
tgcgtggacgcttgtccgacagatgcacttgcagatcttgttgaagagaagggctatgca
gaagacaatcaggtgaaacacaactttccatacgttgcagggggtatgaaataa

DBGET integrated database retrieval system