KEGG   Bacillus selenitireducens: Bsel_1978Help
Entry
Bsel_1978         CDS       T01243                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bse  Bacillus selenitireducens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bsel_1978
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_1978
   00620 Pyruvate metabolism
    Bsel_1978
   00650 Butanoate metabolism
    Bsel_1978
  Lipid metabolism
   00071 Fatty acid degradation
    Bsel_1978
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bsel_1978
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bsel_1978
   00626 Naphthalene degradation
    Bsel_1978
Enzymes [BR:bse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bsel_1978
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bsel_1978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2187304..2189910)
Genome map
AA seq 868 aa AA seqDB search
MAIEEKDLKKQESAEQMIDQLVKRGKSAYEAFLHYDQEQIDEIVKQMALAGLDQHMPLAK
MAVEETGRGVYEDKIIKNIFATEYVYHGIKYDKTVGVVRENEHEEMIEIAEPVGVVAGVT
PVTNPTSTTMFKILIAIKTRNPIIFAFHPSAQKCSAKAASILYDAAVKAGAPEGCIQWIE
KPSIEATQSLMNHNGVAVVLATGGAGMVKSAYSTGKPALGVGPGNVPCFIERSAHIKQAV
NDLILSKTFDNGMICASEQAVIIEAPIYQETKKELIDNKCHFLTKDEREKVEKLVINEKT
CAVNPAIVGMPAAKIAEMAGVTVPAETKILIAELKTVGPESPLSREKLSPVLACYKVKDR
EEGYQRSTEMLEFGGLGHSAVIHSQNDEVIQEFGMRMKAGRIINNSPSSQGAIGDIYNGY
LPSLTLGCGSHGHNSVSQNVGTINLVNFKKIGKRRNNMQWFKVPPKIYFEKNSTQYLEKM
PNISRAMIVTDEMMVKMGYVDKVLYYLNKRQDKVQYEIFSDVEADPSIETVMKGADMMRT
FEPDVIITLGGGSPMDAAKGMWLFYENPDLDFNGLKQKFLDIRKRVFKYPKLGKRAQFVA
IPTTSGTGSEVTSFSVITDKANQTKYPLADYELTPDVAIIDPVYVKSVPPSVTADTGMDV
LTHAIEAYVSVLANDYTDGLAMKAIELVFEYLPKAYHDGSDELAREKMHNASTIAGMAFA
NAFLGINHSLAHKLGAEFHIAHGRSNTILMPHVIRYNAKKPTKFTAFPKYSHFKADERYA
DIARRLGLPASTTEQGVESLVQAVIDLAKEMKIPMSIAECGVDKKDFESVVDELADRAFE
DQCTTANPKLPLVTELADIYRQAYKGIK
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaagagaaagatttaaagaaacaggaaagtgctgaacagatgattgatcag
cttgtaaaacgcgggaaatcagcttatgaggctttccttcattacgaccaggagcagatt
gatgaaattgtaaaacagatggcactcgctggtcttgatcagcatatgccacttgcaaaa
atggctgtggaagaaaccggtcggggagtatatgaagacaagattatcaaaaacatcttt
gccactgaatatgtctatcatggtatcaaatacgataaaactgtcggtgtagtccgcgaa
aatgagcacgaagaaatgattgagatcgcagaacctgtcggcgttgttgcaggtgtcacg
ccagttaccaatccgacatccacgaccatgtttaaaattctgattgcgattaaaacaaga
aatccgattatcttcgccttccatccatccgcacaaaaatgcagcgctaaagctgcaagc
atcctatacgatgccgccgtaaaagcaggtgctccagaagggtgcattcagtggatcgaa
aaaccttcgattgaagcaacgcaatctttaatgaaccataacggggtagctgttgttctt
gccactggtggagccggtatggtgaaatcggcatacagcacaggaaaaccggctctcggt
gttggacctggtaacgtaccgtgctttatcgagcgcagcgcacacattaagcaggctgta
aacgacctgatcctttcaaagacgttcgataatggcatgatatgcgcatctgaacaggct
gtaattatcgaagctccgatttatcaggaaaccaaaaaagaactgatcgacaacaagtgt
catttcctaacaaaagatgagagagaaaaggtagagaagctcgttattaacgaaaaaaca
tgcgcagtaaacccggcaatcgttgggatgcctgccgctaaaattgcagaaatggccggc
gttaccgtacctgcagaaacaaagattctgatcgctgagttaaaaacggttggaccggaa
tcacctttgtcccgggaaaaactgagccctgttcttgcctgctataaggtaaaagaccgc
gaagaaggctatcagcgttcgacagaaatgctcgaattcggaggccttggtcactccgca
gtcatccattcacagaatgatgaagtcatccaggaattcgggatgcgtatgaaagcggga
cgcatcatcaataacagtccttcctcacaaggcgccatcggggatatttacaatggctat
ttgccatcattgactctcgggtgcggttctcacggacacaactccgtttctcaaaacgtg
ggtacgatcaaccttgtcaatttcaaaaaaatagggaagagacgaaataatatgcagtgg
tttaaggttccgccaaagatctatttcgaaaagaattcaacgcaataccttgagaaaatg
ccgaatatctcacgtgccatgattgtcacggatgaaatgatggtcaagatgggctatgtg
gataaagtgctttactatttgaataaacgtcaagataaagttcaatacgaaattttctcc
gatgtcgaagcggatccaagcatcgaaacagtgatgaaaggtgccgacatgatgcgtact
tttgaaccggatgtcatcatcactctcggtggcggttctccaatggatgcagcgaaaggt
atgtggctcttctatgaaaatcccgatctcgatttcaacggattaaaacagaaattcctg
gatatccgtaaacgggttttcaaatatccgaaactcggtaaacgtgcgcagtttgtagct
attccgacaacttccggaaccggttctgaagtcacatcattctctgtcattacagataaa
gccaatcagacaaaatatccgcttgcggattatgagctgactccagatgtggccattatc
gatccagtctatgtaaaatctgtaccgccatctgttacagcagacacaggaatggacgta
ttgacacatgccattgaagcatatgtctcagtcctggctaatgattatacagacggcctt
gccatgaaggcgattgaactggtctttgaatacctgccgaaagcttaccacgatggaagt
gacgaactggctagagaaaaaatgcataatgcatctacaattgccggtatggcctttgcc
aatgccttcctcggtatcaatcacagccttgctcacaaactgggtgctgagttccatatc
gcacacggcagatccaacaccattctgatgccgcatgtgatccggtacaatgcgaagaaa
ccgacgaaattcacagcattcccaaaatacagtcactttaaggcagacgagcgttatgca
gatattgcaagaagactcggcttacctgcaagtacaacagagcaaggggtggagagcctc
gttcaggctgttatcgaccttgccaaagaaatgaagatccctatgagtattgccgaatgc
ggtgttgacaaaaaggattttgagtccgttgttgatgaactggcggatcgcgcattcgaa
gatcagtgcacaacggctaatccaaaactgcctctggtaactgaactggccgatatctac
cgacaagcctataaaggaatcaaataa

DBGET integrated database retrieval system