KEGG   Bacillus selenitireducens: Bsel_2008Help
Entry
Bsel_2008         CDS       T01243                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bse  Bacillus selenitireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsel_2008
   01230 Biosynthesis of amino acids
    Bsel_2008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_2008
   00030 Pentose phosphate pathway
    Bsel_2008
   00051 Fructose and mannose metabolism
    Bsel_2008
   00052 Galactose metabolism
    Bsel_2008
  Energy metabolism
   00680 Methane metabolism
    Bsel_2008
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Bsel_2008
Enzymes [BR:bse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Bsel_2008
Protein phosphatases and associated proteins [BR:bse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bsel_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2228509..2229468
Genome map
AA seq 319 aa AA seqDB search
MNKIAVLTSGGDAPGMNAAIRAVVSASHYHGIEVYGVYRGYKGLMDGSIQPLTTESVAGV
IHKGGTILKSARSEEFKQPENRQKGIDQLRSLGIKGLVVIGGDGSFIGAQKLAEEGIATI
ALPGTIDNDLAYTDETIGFDTAVNTVLDAITKIRDTSFSHEKPTIIEVMGRYCGDIALYA
GIAGGAGTIIIPEEKGTKDQMIEQIRQGHEKGSLDHIIMLAEGVQSASSLQSELKEKYGI
SSRISVLGFIQRGGDPTSRDRILASRMGVEAVELLKNGHSGRAVGIRNNQIYHLSISHAL
KKEKTIDQSMYHLTNLLSL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaattgctgttttaacaagcggtggtgatgcacccgggatgaacgcagcgatt
cgagctgtagtcagtgcctctcactatcatggtatcgaagtatatggtgtttatcgcggt
tacaaaggattgatggatgggagcatccagccattgacgacggaatcggtggccggggtg
atccacaaaggaggaaccattctcaaatcagcaaggtcagaggaattcaaacaacctgaa
aaccggcaaaaaggcattgatcagctccgttctctggggatcaaaggactcgtagtgatt
ggtggagacggctcgtttatcggtgcacaaaaattggctgaagaaggcattgccactatt
gcccttcctggcaccattgataatgaccttgcctatacggacgaaacaatcggttttgat
acggctgtcaatacggtactcgatgcgatcaccaaaatccgtgacacctccttttcccat
gaaaaaccaaccatcattgaagttatgggacgctattgcggtgatatcgcattgtatgca
gggattgccggtggtgcaggtacaattattatccctgaagaaaagggtacgaaagatcag
atgattgaacagatcagacagggacatgaaaagggcagtcttgatcatatcattatgctt
gccgaaggggttcagagcgcctcttccctgcaaagcgaattaaaagaaaaatacgggatc
agtagcagaatcagcgttctcggtttcattcagcgcggcggagaccctacatcccgtgat
cgcattcttgcgagtcgcatgggcgtggaagcggttgagctattgaaaaacggtcattca
ggaagagcggtcgggattcggaataatcagatttaccacctttcaatcagccatgcgtta
aagaaagagaaaacgattgatcagtctatgtatcatttgaccaatttgttatctttatag

DBGET integrated database retrieval system