KEGG   Bacillus selenitireducens: Bsel_2022Help
Entry
Bsel_2022         CDS       T01243                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bse  Bacillus selenitireducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bsel_2022
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bsel_2022
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bsel_2022
Enzymes [BR:bse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bsel_2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2244116..2245282)
Genome map
AA seq 388 aa AA seqDB search
MKDTETVKEGYFGDFGGSFVPPALQEVLDRLDQAFQSFKHDDAFNREYKECLKEFVGREN
PLTYARHLTEAFGGPKVYLKREDLNHTGSHKINNVIGQILVAKYMGAHRIIAETGAGQHG
VATATACAMFGMDCLIYMGELDMKRQSLNVFRMELLGAEVVPVSAGQGRLKDAVDAALGD
LVENYDHTFYLLGSAVGPHPYPTMVKHFQAISSEESKRQIMEKEGRLPAAVFAVTGGGSN
AIGAFAHYIDEKNVRLIGVEPEEAATMSKGTPAVIHGFKCLVLQDEEGNPLPTYSIAAGL
DYPGIGPEHSFLKTSGRAEYYTISKEEVLEAFKLLSRKEGILPALESAHAVAMAQKLAGE
FSPDEPVIINISGRGDKDVEQVFEMLKT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacacagagacagttaaagaagggtattttggtgattttggcgggagctttgtt
ccacctgcgcttcaggaggtactcgacagactcgatcaggcttttcaatcattcaaacat
gatgatgcctttaatcgtgaatacaaagaatgccttaaggaatttgtcgggagggagaat
cctctgacgtatgcaaggcatttaacggaagcattcggcggccctaaagtttatttgaag
cgtgaagacctgaatcacaccggttcacataaaattaataatgtcatcggtcaaattctt
gtcgccaaatatatgggtgctcaccggatcattgcagaaaccggagcaggtcagcatggt
gtcgccacggcgacggcatgtgcgatgtttggcatggactgcttgatttacatgggtgaa
ctcgatatgaagcggcaatcactgaatgtgttcaggatggagcttttgggagctgaggtc
gtacctgtcagtgccggccaaggacgtttaaaagatgcggttgatgcagcgcttggcgac
ctagttgagaattatgatcatacgttttatcttctcggttctgcggttggtcctcatccg
tatccgacgatggtaaaacattttcaggccatcagcagtgaggagtcgaaacggcagatt
atggagaaagaaggcagacttcctgcggctgtattcgctgtcactggtggcgggagcaat
gccatcggagcatttgcccattatatcgatgagaaaaatgtgcggctgattggggtcgag
ccggaagaagctgccactatgtccaaaggcactcctgcggtaatccacgggtttaaatgt
ctcgttctgcaggatgaggagggaaatcccttgccgacctattcgatcgccgcgggactt
gattaccccggtatcggaccggagcacagttttttgaaaacaagtggacgtgctgaatat
tatacaatctcaaaagaagaggtccttgaggcgtttaaactcctttcaagaaaagagggg
attctccctgcgcttgagagtgctcacgctgtggcaatggcacaaaaactcgccggagaa
ttttcacccgatgagccggttattatcaacatttccggccgcggcgataaagatgtggaa
caggtttttgaaatgctgaaaacgtaa

DBGET integrated database retrieval system