KEGG   Bacillus selenitireducens: Bsel_2044Help
Entry
Bsel_2044         CDS       T01243                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bse  Bacillus selenitireducens
Pathway
bse00020  Citrate cycle (TCA cycle)
bse00310  Lysine degradation
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01120  Microbial metabolism in diverse environments
bse01130  Biosynthesis of antibiotics
bse01200  Carbon metabolism
Module
bse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bsel_2044
  Amino acid metabolism
   00310 Lysine degradation
    Bsel_2044
Enzymes [BR:bse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bsel_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADH99548
JGI: Bsel_2044
UniProt: D6XUR2
Position
complement(2274732..2275997)
Genome map
AA seq 421 aa AA seqDB search
MIEIKVPELAESITEGTIAKWLKSPGDTIEKGDDIVELETDKVNVEVHAEASGILSEVLF
EEGDTVQVGDVIARLEAGNNDDKENEQQNEDTESTSDTAKADAGNDQKEAVSSDSSGQTE
KNKEQERIIASPATRKYAREKGIDLKDIQPADPMGKVTNRDIDHHSQGKTNQNQSTDSSS
DTHDDDIRKPVRREKMSRRRQTIAKRLVEAQQTAAMLTTFNEVDMTNLMALRDRRKDKFQ
DDFGVKLGFMSFFTKAVIGALKKYPYVNAEIDGDEIILKDFYDIGMAVSTEDGLVVPVVR
DADRLDFAGIEKEIGHLAEKAHGKKLGLEDLQGGSFTITNGGVFGSLWSTPILNSPQVGI
LGMHTIQKRPVATGDDTFENRPMMYIALSYDHRIIDGKDAVGFLVKVKELIEDPESLLLE
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagattaaagttccggaacttgctgaatccattacagaaggtaccatagcaaag
tggttaaaatcacccggcgataccattgaaaaaggtgacgatatcgttgagctcgagacg
gataaagtcaatgtcgaggtccatgcagaagcatcagggattttaagtgaagtcctgttc
gaagaaggggacactgttcaggtcggagatgtaattgcacgacttgaagccggcaataat
gatgacaaagaaaatgaacagcaaaatgaagatacagagtcaacgtcggacacagcgaaa
gctgatgcaggaaacgatcaaaaggaagctgtatcttctgactcttcagggcaaactgaa
aaaaataaagagcaggagcgaatcatagcatcgccggcaacaagaaaatacgcaagagaa
aaagggattgatctgaaagatattcaacctgccgatcctatgggtaaagtcaccaatcgg
gatattgatcatcatagccaaggtaaaaccaatcaaaatcagtcaaccgattcttcatca
gatactcatgatgatgacatcagaaaaccggtcagacgcgaaaaaatgtcaagaagacgt
caaaccattgcaaaacggttggttgaagcccaacagactgctgcgatgctgaccaccttt
aacgaagtcgatatgactaatctcatggcattaagagatcggcgaaaagataaattccaa
gatgatttcggtgttaaactcggttttatgtcttttttcacaaaagccgtcatcggtgct
ttgaaaaaatatccatacgtcaatgcggaaattgacggggatgaaatcattcttaaagat
ttctatgatattggcatggcggtttccacagaggatggcctggttgttcccgttgttcgt
gatgcagacagacttgattttgcgggtatcgaaaaagaaatcggtcacttagcggagaaa
gcccatggtaaaaaactcggcttggaggatttgcagggaggcagcttcaccatcacgaat
ggaggagtattcggttcactttggtcaacgcctatactcaattcaccccaggtagggata
cttggcatgcacaccattcagaagcgacctgtagcaacaggggacgacacatttgaaaat
cggccgatgatgtacatcgctctgagttatgatcacagaatcattgatggtaaagatgct
gtcggctttctcgtgaaagtaaaagaattgattgaagatccggaatccctgcttcttgaa
ggataa

DBGET integrated database retrieval system