KEGG   Bacillus selenitireducens: Bsel_2054Help
Entry
Bsel_2054         CDS       T01243                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bse  Bacillus selenitireducens
Pathway
bse00010  Glycolysis / Gluconeogenesis
bse00620  Pyruvate metabolism
bse00640  Propanoate metabolism
bse00680  Methane metabolism
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01120  Microbial metabolism in diverse environments
bse01130  Biosynthesis of antibiotics
bse01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_2054
   00620 Pyruvate metabolism
    Bsel_2054
   00640 Propanoate metabolism
    Bsel_2054
  Energy metabolism
   00680 Methane metabolism
    Bsel_2054
Enzymes [BR:bse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bsel_2054
Lipid biosynthesis proteins [BR:bse01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bsel_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Glyco_tranf_2_4 ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADH99558
JGI: Bsel_2054
UniProt: D6XUS2
Position
2286760..2288472
Genome map
AA seq 570 aa AA seqDB search
MEKLMPESGHTQLQDYDKTREEFSWTETEKEFSWYKTGKVNAAYECIDRHVANGNGAKTA
LLYSDQSRDEVYSFEDLMKTTNQAAHMFKRLGIEKGDRVFIFMPRSPELYTALLGAIKAG
AVTGPLFEAFMKEAVRARLEDSEAVSIVTTPELLQRIPVDELPHLKTIIIYGEHDISDER
FYSFSDEMKASSDDDGAIEWMDREDGMILHYTSGSTGKPKGVYHVHNAMIQHYQTAKWVL
DLKADDIYWCTADPGWVTGTSYGIFGPWLNGITNVVRGGRFSPGDWYGTIEKYSVTVWYS
APTAFRMLMSAPRDILEKADLGSLRHVLSVGEPLNPEVVRWGMEAYGKRIHDTWWMTETG
GMLICNYPSEPIKPGSMGKPFPGITAAILDNQGKEVPPGEMGHLAIKAGWPSQMRKIWKN
EAKFKDYFYFDGWYVSGDTAYMDEEGYFWFQGRNDDVINTSGERVGPFEIESKLVEHPAV
AEAGVIGKPDELRGQIIKAFISLRSGYTFSDELKEDIQAFIKSELSAHAVPREIEYKEKL
PKTRSGKIMRRVLKAWELDEPAGDLSTMDD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactaatgcctgaatcaggacatactcaacttcaagattatgacaaaaccaga
gaagagttttcatggactgaaacagaaaaggaattctcctggtataagaccgggaaagtc
aatgctgcatatgagtgcattgaccgacatgttgcaaatggaaatggtgcaaagactgcc
ctgttgtactccgatcaatcaagagatgaggtatattcattcgaagatcttatgaaaaca
acgaaccaggctgcacacatgtttaaacgcctcggtatcgaaaaaggagaccgggtattc
attttcatgccgagatctccggaactctatacagcccttctcggtgccattaaagccggg
gcggtaacaggaccattgtttgaagctttcatgaaagaagccgtcagggcaaggcttgaa
gacagcgaggctgtgtcgattgtcacaactcctgaactgcttcagcggatcccggttgat
gaacttccacatttgaaaaccattattatttatggtgagcacgacatatccgatgaacgg
ttttattccttttctgacgaaatgaaagcgtcttcagatgacgatggagctattgagtgg
atggaccgggaagacgggatgattcttcactacacatccggttcaacaggaaaaccaaaa
ggcgtttatcatgtccataatgcgatgattcagcactatcaaactgctaagtgggttctt
gatttaaaagcagatgatatatactggtgcaccgctgatccaggttgggtcaccggtacg
agttacggtatattcggtccatggttaaacggtatcacaaatgttgtaagaggcgggcga
ttctcaccgggggattggtatggcaccatcgaaaaatacagcgttacagtctggtattca
gcgccaactgctttcagaatgctgatgtccgcaccgagagatatccttgaaaaggctgat
ttggggtcattaagacacgtattaagtgttggggagccgcttaatcctgaggttgtgaga
tggggtatggaggcctacggcaaacgaatccatgatacatggtggatgactgaaacaggc
ggtatgcttatctgcaattacccatccgaaccaataaaacccggatccatgggaaaaccg
tttcccggtattacggcagctattctcgataatcaggggaaggaagttccgcccggggaa
atggggcacttggccatcaaagcaggctggccatcacaaatgagaaaaatatggaaaaat
gaagcgaagtttaaggattacttttattttgacggctggtatgtatcaggtgatactgct
tatatggatgaagaaggctacttttggtttcaaggccgtaacgatgatgtgattaataca
tccggagaacgagtggggccatttgaaattgagagtaagcttgtggaacaccccgccgtt
gcagaagcaggcgtcattggcaaacccgatgaactgagaggtcaaattattaaagcattt
atctctttgaggtccggatatacgttttctgatgaattaaaagaagatattcaggccttt
atcaaatctgaactttccgcacatgcggtgccaagagaaatcgaatataaagaaaagtta
ccgaaaaccagaagcggaaagatcatgagacgggtactcaaagcatgggaactcgatgaa
cctgcaggagacctgtctacaatggatgattaa

DBGET integrated database retrieval system