KEGG   Bacillus selenitireducens: Bsel_2067Help
Entry
Bsel_2067         CDS       T01243                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bse  Bacillus selenitireducens
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bse00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bse00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2302116..2302802
Genome map
AA seq 228 aa AA seqDB search
MINSVDHDLRENSLITLAGTVGVGKSTLTTVLSDALAFTPAFEKVDGNPYLEDYYDDFQK
WSFHLQMYFLAERFKQQKTMHEQNIGYVQDRSIYEDVGIFAQLQYDQGNMTQRDFNTYHS
LFEAMVMNPYFPKPDVLIFIDGRFESIMDRIQKRGREMEVNTPVEYWRDLYNRYKSWIHT
FHECPILHLDIDYYDCHNQDSVEKIVKAIEHLQKNRDVRYLNLSETNA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattctgtagatcacgatttgagagaaaactctctcatcacgctcgccggaacc
gtcggtgtcggaaaatccacattaacaactgtattgtcagatgcccttgcttttactcct
gctttcgaaaaagttgatggaaacccttatcttgaagactattacgacgattttcaaaag
tggtcatttcatcttcaaatgtattttcttgctgaacggtttaaacagcaaaaaaccatg
catgagcaaaatatcggttatgtacaagaccgaagtatctatgaagacgttgggatcttc
gctcaacttcagtacgatcaaggtaacatgactcaaagggattttaatacttatcactca
ctattcgaagcgatggttatgaatccatattttccaaaaccggatgttctgatctttatt
gatggacgttttgagagcatcatggatcggatacaaaaacgcggacgggaaatggaagta
aatacgcccgttgaatattggcgtgatctttataatcgttacaaaagctggatccataca
tttcatgaatgcccaatccttcatctcgatattgattattacgactgccataaccaggac
tcagtggaaaaaatcgttaaagccattgaacatctgcaaaaaaaccgcgacgtgcgttac
cttaatttatcggaaacaaatgcataa

DBGET integrated database retrieval system