KEGG   Bacillus selenitireducens: Bsel_2067Help
Entry
Bsel_2067         CDS       T01243                                 

Definition
(GenBank) deoxynucleoside kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bse  Bacillus selenitireducens
Pathway
bse00230  Purine metabolism
bse00240  Pyrimidine metabolism
bse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bsel_2067
   00240 Pyrimidine metabolism
    Bsel_2067
Enzymes [BR:bse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Bsel_2067
    2.7.1.76  2'-deoxyadenosine kinase
     Bsel_2067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 ABC_tran AAA_25 AAA_28 TsaE Thymidylate_kin RsgA_GTPase AAA_33 AAA_29 CbiA AAA_16
Motif
Other DBs
NCBI-ProteinID: ADH99571
JGI: Bsel_2067
UniProt: D6XUT5
Position
2302116..2302802
Genome map
AA seq 228 aa AA seqDB search
MINSVDHDLRENSLITLAGTVGVGKSTLTTVLSDALAFTPAFEKVDGNPYLEDYYDDFQK
WSFHLQMYFLAERFKQQKTMHEQNIGYVQDRSIYEDVGIFAQLQYDQGNMTQRDFNTYHS
LFEAMVMNPYFPKPDVLIFIDGRFESIMDRIQKRGREMEVNTPVEYWRDLYNRYKSWIHT
FHECPILHLDIDYYDCHNQDSVEKIVKAIEHLQKNRDVRYLNLSETNA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattctgtagatcacgatttgagagaaaactctctcatcacgctcgccggaacc
gtcggtgtcggaaaatccacattaacaactgtattgtcagatgcccttgcttttactcct
gctttcgaaaaagttgatggaaacccttatcttgaagactattacgacgattttcaaaag
tggtcatttcatcttcaaatgtattttcttgctgaacggtttaaacagcaaaaaaccatg
catgagcaaaatatcggttatgtacaagaccgaagtatctatgaagacgttgggatcttc
gctcaacttcagtacgatcaaggtaacatgactcaaagggattttaatacttatcactca
ctattcgaagcgatggttatgaatccatattttccaaaaccggatgttctgatctttatt
gatggacgttttgagagcatcatggatcggatacaaaaacgcggacgggaaatggaagta
aatacgcccgttgaatattggcgtgatctttataatcgttacaaaagctggatccataca
tttcatgaatgcccaatccttcatctcgatattgattattacgactgccataaccaggac
tcagtggaaaaaatcgttaaagccattgaacatctgcaaaaaaaccgcgacgtgcgttac
cttaatttatcggaaacaaatgcataa

DBGET integrated database retrieval system