KEGG   Bacillus selenitireducens: Bsel_2124Help
Entry
Bsel_2124         CDS       T01243                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bse  Bacillus selenitireducens
Pathway
bse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bse01100  Metabolic pathways
bse01110  Biosynthesis of secondary metabolites
bse01130  Biosynthesis of antibiotics
bse01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bsel_2124
Enzymes [BR:bse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bsel_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NCD1 His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADH99628
JGI: Bsel_2124
UniProt: D6XUZ2
Position
complement(2355223..2356002)
Genome map
AA seq 259 aa AA seqDB search
MKTILEKITDTKKDELTRIVLPASRMTDAPKRSLTEAIRHSDWPVGVIAEVKKASPSRGV
ISQDFDPEQIAKAYEQAGANGISILTDEQYFQGHSEYLTRIKQTSSVPLLRKDFIIDSLQ
VKESERMGADAILLIAAILEPSALQEYYDEAVELGMDVLVEVHNQKETEDVLSVVTPALL
GVNNRDLHTFHTDLAVTEQLAHLIPDESMLISESGIRTNADIKRIQKAGSKGILAGESFM
LAEDKTRFINELMNGEVTS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccattcttgaaaagattacagatacaaaaaaagacgaattgacgagaattgtt
cttcctgcatccaggatgacggatgcaccgaaacgttctctgacggaggccattcgtcat
tcagactggcccgttggcgtgattgcagaagtgaaaaaagccagtccctcaagaggcgtc
atcagtcaggattttgatcctgaacagattgctaaagcttatgaacaggccggtgccaat
gggatttcgattctgacagatgaacagtatttccaggggcactcggagtatttaacaagg
attaaacaaacatcatcggtccctttgttgcgtaaagattttattatcgattctctgcag
gtgaaagaatcagagcggatgggggcggatgcgattttgttaattgctgcgatactcgaa
ccatcagctctgcaggaatattatgatgaagccgtggaactcggcatggatgtccttgtc
gaagttcacaatcaaaaggaaaccgaggatgtgctctctgttgtgacacccgcccttcta
ggagtaaacaaccgtgatcttcatacctttcatacggatttagcggtaaccgaacagctt
gctcatctgattccggatgaatccatgctgatcagtgaaagcgggatccggacaaatgcg
gatataaaacggattcaaaaggccggatccaaagggattcttgccggagaatcattcatg
ctcgctgaggataaaacacgcttcatcaatgaattgatgaacggggaggtgacgtcttga

DBGET integrated database retrieval system