KEGG   Bacillus selenitireducens: Bsel_2234Help
Entry
Bsel_2234         CDS       T01243                                 

Definition
alpha amylase catalytic domain-containing protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bse  Bacillus selenitireducens
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bsel_2234
Enzymes [BR:bse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Bsel_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2453905..2455356)
Genome map
AA seq 483 aa AA seqDB search
MTVKNEIMLITYADSLGKNLKELDEVLETHFKDAVGGVHLLPFYPSSADRGFAPMTYQEV
DPAFGGWSDVERIAKKYDTMYDFMINHISKSSEYFQDFMEKKDDSPYADLFIQYKDFWPG
GEPTQEDVDKIYKRKPRAPYIDVTFGDGSTEKIWCTFDEEQIDLNVYHERTKAFMRENLT
FLAEKGASIIRLDAFAYATKKPGTDCFFLEPDTWEMLDEIQTILEPIGCEILPEIHEHYT
IQLKLAERGYYVYDFALPMLVLHALYSGRTDRLAHWLNIAPRKQYTTLDTHDGIGVVDVA
DLMTQEEIEATRDDLFTKGANVKRVYNTMEYNNLDIYQLNCTYYSALGDDDQAYLLARAI
QFFAPGIPQVYYVGLLAGKNDIELLEETKVGRNINRHYYTKEEIAEEMKRPVMAKFMKLM
TFRNDYKAFDDQIDITEREDGQVLEIVRTTGDNQAILTANVETHAFTITYKDEQTGDMKE
LVL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgaagaatgaaattatgttgataacgtatgccgacagtctggggaagaacctg
aaggagcttgacgaggtgcttgagacgcacttcaaagatgctgtgggcggtgtgcattta
ctgccgttttatccgtcgagtgcggaccgggggtttgcgccgatgacttaccaggaagtg
gatccggcgttcggcggttggtctgacgtggaacggatcgcgaagaagtatgacacgatg
tatgattttatgatcaaccatatttcgaagagctcggagtattttcaggactttatggag
aagaaggacgattctccttatgccgatttgtttattcaatacaaagatttctggccgggc
ggggaaccgacgcaggaagacgtggataaaatctacaagcgtaagccgagagcgccatat
attgatgtgacgttcggtgacggctcgacggagaagatctggtgcacgtttgatgaggaa
cagatcgatctgaatgtgtatcatgagcgaacgaaggccttcatgcgggagaacctgacg
ttccttgcggagaaaggggcttcgatcatccgtttggacgcttttgcgtatgccacgaag
aaaccgggaacagactgcttcttccttgagccggatacgtgggagatgcttgatgagatc
cagacgattcttgagccgatcggctgtgagatcctacctgaaatccatgagcactacacg
attcagctgaaacttgccgaacgggggtattatgtgtacgactttgccctgccgatgctt
gttttgcacgccctttacagcgggcgaacggaccggctcgcacactggctcaacattgcc
ccgagaaaacagtacacgacccttgacacccatgacgggatcggtgtcgttgacgtggcg
gatctcatgacccaggaagagatagaagcgacccgggacgacctctttacgaaaggggcg
aatgtgaagcgggtgtacaatacgatggagtacaataacctcgatatctatcagctgaac
tgcacgtattacagtgcccttggtgacgacgatcaggcgtatctcctcgcacgggcgatc
cagttcttcgcgccggggattccgcaagtgtactacgtcggtttactggcaggaaagaat
gacattgagctcttggaagagacaaaagtcggccgtaacatcaaccggcactattataca
aaggaagagatcgcagaagagatgaagcggccggtgatggcaaagtttatgaagctcatg
acgttccggaatgactacaaagctttcgacgatcagattgacataacggaacgtgaagat
gggcaggtgcttgaaattgtccgaacgacaggagataatcaggccatactgacggcaaac
gtcgagacgcatgcgtttaccatcacctataaagacgaacagaccggtgacatgaaggag
cttgtgctgtaa

DBGET integrated database retrieval system