KEGG   Bacillus selenitireducens: Bsel_2443Help
Entry
Bsel_2443         CDS       T01243                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bse  Bacillus selenitireducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bse00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bsel_2443
Enzymes [BR:bse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bsel_2443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2662579..2664879)
Genome map
AA seq 766 aa AA seqDB search
MADEQNETKTFIQGELIAQVFHAPETLYTVAKIRVKKASDDIDEKEMTVVGPMKPPEKDM
VYRFEGSLTEHPLYGRQLQFDSCETVMPETGEGIVLYLSSDRFEGIGRKTAQSIVSVLGE
SAISKILENRKVLDDVPNMNEAKKEILVSQLKEDQGIEGILTKLYDFGFGVKMALKVYQA
YQESALDIMEQNPYRLVEDIEGIGFQKADQIGRKQGLTVNHGDRLKAGLLFCLQEETFSN
GHTYIEATELLVLADQLLSAGVTEPIDESSLSQQLLELEEEDKIRYENGRCFVPSLYHAE
RGIVTHMDRLLNRMEQVDQFPEAEIYKALGEVEEELGITYAESQREAVFTGLHSPVMILT
GGPGTGKTTVIEGIVKVFGRLKGVSVDPAEYGKKDGPFPIVMAAPTGRAAKRMTESTGLP
ASTIHRLLGYKGENEGYFEKDDDDPIDGELLIIDEVSMVDTWLMNQLLKATPTWMQVIFV
GDEDQLPSVGPGQVLEDLLASDAAPNVRLVDIFRQEEGSRIIDFSHQIKESRLPPEGIDT
SNKDLRFFPCQTQGVQTIVRQVCEGAVKKGYHARDIQVLAPMYKGEAGVDALNVMLQNLF
NPKRERVREVQFGEVTYRVGDMVLQLINDPENNVFNGDRGEIVSIIRAKETVEKVMKITI
SFNGEEVDYERNDLNMITHAYCCTIHKSQGSEFPIVVMPVVKSYWRMLRKKLIYTGATRA
KGYLILCGEWDALEKAVVTGEETLRRTTLKERLLSVVPAKEKEEGR
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaacagaacgaaacaaaaacgttcatacagggtgaactgatagcccaggtg
tttcatgcacctgaaacgctctataccgtggcgaagatccgggtgaaaaaggcgagtgac
gacatcgatgaaaaagagatgacggtagtcggtcccatgaaaccgcctgaaaaagatatg
gtttaccgctttgaaggcagtctgacggaacatccgctttacggcaggcagcttcagttt
gattcctgtgaaacggtcatgccggaaacgggcgagggaattgtgctgtatttgtcgagc
gaccgtttcgaaggaattggccgcaaaaccgcccagtccatcgtgagtgtcctcggtgag
agcgccatatcgaaaattcttgaaaaccgtaaggtactcgatgacgttccgaacatgaac
gaagccaaaaaagagatcctcgtcagtcagctcaaagaagatcaggggatcgagggtatt
ttgacaaagctgtatgattttggatttggcgtgaagatggcgctgaaggtctatcaggcc
tatcaggaaagtgcccttgatatcatggaacagaatccctatcgccttgtggaggacatc
gaaggcatcggctttcaaaaagccgatcagattggccgtaagcagggactgaccgtgaac
cacggggaccgtttaaaagcagggcttctcttttgtcttcaggaagagaccttctcaaac
ggtcatacatatatcgaggcgacggagctgcttgttcttgcagaccagcttctttctgcc
ggcgtgacggagcccattgatgagagcagtctcagccaacagctccttgaacttgaagaa
gaagacaaaatccgctatgaaaacggacgctgcttcgtgccgtcgctttatcatgcggag
cgggggattgtcacccatatggaccgtctgttaaaccggatggaacaggtggaccagttt
ccggaggcggaaatatacaaagccctcggcgaagtggaggaagaactgggcatcacctat
gcggagtctcagcgcgaagccgtattcacaggtcttcattcaccagtcatgattctgaca
ggtggacccggtacagggaaaaccactgtcattgaaggaattgtcaaagtgtttggccgg
ctgaaaggcgtctcggtggatcctgccgagtacgggaaaaaagatggcccgtttccgatt
gtcatggcggcaccgacaggacgcgctgcaaagcgaatgacagaatccacaggacttccg
gcctccacgatccaccggctcctcggttataaaggtgaaaacgaagggtatttcgaaaaa
gatgatgatgatcccattgacggtgagctcctgatcattgatgaggtgtccatggtggat
acgtggctgatgaatcagctcttaaaagcgacaccgacctggatgcaggttatatttgtc
ggtgatgaggatcagcttccgagcgtcggaccgggtcaggtattggaggacctgctggcc
tcggatgcggcgccgaacgtgcggcttgtcgatatcttccgacaggaagaaggatcgaga
atcatcgatttttcccatcagattaaagaaagccgattgccgccggagggaatcgatacg
tcgaataaagacttgcggtttttcccttgtcagacgcaaggggtgcagacaatcgtcaga
caggtttgtgaaggcgcagtgaaaaagggctatcacgccagggatatacaggtgctcgcc
ccgatgtataaaggggaggccggtgtggacgcattaaacgtcatgctacagaatctgttt
aacccgaagcgtgaacgcgtgcgtgaagtgcagtttggtgaggtgacctaccgcgtcggc
gatatggtccttcaactgatcaatgatccggaaaataacgtctttaacggtgaccgggga
gagatcgtgtcgatcatcagggcgaaagaaaccgttgaaaaagtcatgaaaatcacgatt
tcctttaacggggaggaagtcgattatgaacggaatgatctgaatatgatcacccatgcg
tattgctgtacgattcataaatcacagggcagtgagtttccgatcgtcgtaatgcccgtt
gtgaaaagctattggcggatgctcagaaagaagctcatatacacaggtgcaacgagggcc
aaaggatacctgattctttgcggagaatgggatgctcttgagaaggcggtagtgacaggt
gaagagaccctcagaagaacgacattgaaggagaggcttctgtcagttgtaccggccaaa
gaaaaggaagagggacgttga

DBGET integrated database retrieval system