KEGG   Bacillus selenitireducens: Bsel_2951Help
Entry
Bsel_2951         CDS       T01243                                 

Definition
fructose-16-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bse  Bacillus selenitireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bse01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bse00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bse00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bse00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:bse00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3190857..3192788
Genome map
AA seq 643 aa AA seqDB search
MDTKMLDLLAQRYDSEEKVVTEIIKLEAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGN
VKEKIKDLFQDEFSEAEITEFATLVYYPDEKIPLIKSQFSNRDELNAWYTETIGHMIRLI
SFASFKYTRSKLRKELPPQFVYIIQELLYKTEEFTSKKDYYSEIVRQIISLGQADKLIAG
LAYTTQRLVVDHLHVVGDIYDRGPEPDKIMDALINYHSVDIQWGNHDVLWMGAYAGSKVC
LANIIRICARYDNLDIIEDAYGINLRPLLNLAEKYYDSNPKFMPKSDSGEPLSEHERNQI
SKIQQAIAMIQFKLEMPIIKRRPNFNMSERLLLEKIDYDKMEITIYGKTYPLEHTCFATV
NPAQPDQLLEEEQKVIDKLLFSVQHSEKLARHMNFLMKSGNLYLRYNGNLLIHGCIPLDE
SGNMENMDIDGETYSGRDLLDVFERYLRIAYANPQETDDLATDMVWYLWTGEYSSLFGKR
EMTTFERYFISDKEAHTERKNPYYYLREKEETCRKILEEFDLNPDQGHIVNGHTPVKERS
GESPVKANGKMIVIDGGFSKAYQSDTGIAGYTLLYNSYGMQLVAHKHFHSKEDVLQNGTD
VLSVKRLVDKELVRKKVRETNVGKELLQEVAILKSLMSYRYMS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggatacgaagatgctggatctgttggctcagcgctatgacagtgaggagaaagttgtc
acggaaatcattaagcttgaagccattctcaatctgccgaaaggcaccgaacattttgtc
agtgatctgcacggggagtaccaggcgtttcagcatgtgctgcgaaacggatcagggaat
gttaaagagaaaattaaagacctgtttcaagatgaattttccgaagcggaaatcacagag
ttcgcgacactggtctattatcccgacgaaaaaatacctttaatcaagagtcaatttagt
aacagggatgaattaaacgcatggtatacggaaaccatcgggcatatgataagactgatc
tcctttgcctcttttaaatacacacgctcgaagctccgcaaagaattgcctcctcagttt
gtctacatcatccaggagcttttatacaaaaccgaagaattcaccagcaagaaagactac
tattcagagatcgtccgacagattatttcccttggacaggcggacaaactgattgccggc
cttgcctatacgacgcagcgtctcgtcgttgaccacctgcatgtcgtcggtgatatatac
gaccgtggccccgagcccgacaagatcatggatgccctcatcaactaccattccgttgat
atccagtggggcaatcacgatgtcctctggatgggtgcctatgccggttcaaaagtctgt
ctggcgaatatcatccgcatatgtgcccgttacgacaatttggatattattgaagatgca
tacgggatcaaccttaggcctctgttaaatcttgcggaaaaatactatgacagcaacccg
aaatttatgccgaagagtgattccggtgaaccgctctctgagcatgagcgaaaccagatc
tcaaaaatccagcaggccatcgccatgattcagttcaaactcgaaatgccgatcatcaag
cgacgtcccaattttaatatgtcagagcggcttttactcgaaaaaatcgattacgacaag
atggagatcaccatctacgggaaaacgtatccccttgaacacacctgctttgccacagtg
aatccggcacagcctgatcagctgcttgaagaagaacagaaagtcatcgacaagctgttg
ttttccgttcagcattcggagaagctcgctaggcacatgaattttctcatgaaatcaggc
aatctctatttaagatacaacggcaacttattaatccacggctgtattccattggatgaa
tcgggcaacatggagaatatggacattgatggagaaacctattcaggccgcgacttgctg
gacgtatttgaacgctacttgcgtatagcctatgccaatccgcaggaaacggatgatctg
gcgacagacatggtctggtatctatggacgggggaatattcctccctgtttggaaaacgg
gaaatgactaccttcgaacggtatttcatcagcgacaaagaagcccacacggagcgaaag
aacccgtactactatttacgggaaaaagaagaaacatgcagaaaaatcctggaggaattt
gacctcaatccggatcagggacatatcgtcaacggccacacgcccgtgaaagaacggagc
ggggaaagtcctgtgaaggcaaatggaaagatgatcgtcatcgatggcggcttctccaag
gcttatcagtcagataccgggatcgccggctacaccttgctgtacaattcctacgggatg
caactcgtggcccataaacattttcattcaaaagaagatgttctccaaaacggaactgat
gtattatccgtcaaacggctggtcgataaggaacttgtgcgaaaaaaggtccgggaaacc
aatgtcggaaaagaactgttgcaggaagtggccatcttaaagagtttgatgtcgtaccgc
tatatgagctga

DBGET integrated database retrieval system