KEGG   Bacillus selenitireducens: Bsel_2951Help
Entry
Bsel_2951         CDS       T01243                                 

Definition
fructose-16-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bse  Bacillus selenitireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsel_2951
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsel_2951
   00030 Pentose phosphate pathway
    Bsel_2951
   00051 Fructose and mannose metabolism
    Bsel_2951
  Energy metabolism
   00680 Methane metabolism
    Bsel_2951
Enzymes [BR:bse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Bsel_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3190857..3192788
Genome map
AA seq 643 aa AA seqDB search
MDTKMLDLLAQRYDSEEKVVTEIIKLEAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGN
VKEKIKDLFQDEFSEAEITEFATLVYYPDEKIPLIKSQFSNRDELNAWYTETIGHMIRLI
SFASFKYTRSKLRKELPPQFVYIIQELLYKTEEFTSKKDYYSEIVRQIISLGQADKLIAG
LAYTTQRLVVDHLHVVGDIYDRGPEPDKIMDALINYHSVDIQWGNHDVLWMGAYAGSKVC
LANIIRICARYDNLDIIEDAYGINLRPLLNLAEKYYDSNPKFMPKSDSGEPLSEHERNQI
SKIQQAIAMIQFKLEMPIIKRRPNFNMSERLLLEKIDYDKMEITIYGKTYPLEHTCFATV
NPAQPDQLLEEEQKVIDKLLFSVQHSEKLARHMNFLMKSGNLYLRYNGNLLIHGCIPLDE
SGNMENMDIDGETYSGRDLLDVFERYLRIAYANPQETDDLATDMVWYLWTGEYSSLFGKR
EMTTFERYFISDKEAHTERKNPYYYLREKEETCRKILEEFDLNPDQGHIVNGHTPVKERS
GESPVKANGKMIVIDGGFSKAYQSDTGIAGYTLLYNSYGMQLVAHKHFHSKEDVLQNGTD
VLSVKRLVDKELVRKKVRETNVGKELLQEVAILKSLMSYRYMS
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggatacgaagatgctggatctgttggctcagcgctatgacagtgaggagaaagttgtc
acggaaatcattaagcttgaagccattctcaatctgccgaaaggcaccgaacattttgtc
agtgatctgcacggggagtaccaggcgtttcagcatgtgctgcgaaacggatcagggaat
gttaaagagaaaattaaagacctgtttcaagatgaattttccgaagcggaaatcacagag
ttcgcgacactggtctattatcccgacgaaaaaatacctttaatcaagagtcaatttagt
aacagggatgaattaaacgcatggtatacggaaaccatcgggcatatgataagactgatc
tcctttgcctcttttaaatacacacgctcgaagctccgcaaagaattgcctcctcagttt
gtctacatcatccaggagcttttatacaaaaccgaagaattcaccagcaagaaagactac
tattcagagatcgtccgacagattatttcccttggacaggcggacaaactgattgccggc
cttgcctatacgacgcagcgtctcgtcgttgaccacctgcatgtcgtcggtgatatatac
gaccgtggccccgagcccgacaagatcatggatgccctcatcaactaccattccgttgat
atccagtggggcaatcacgatgtcctctggatgggtgcctatgccggttcaaaagtctgt
ctggcgaatatcatccgcatatgtgcccgttacgacaatttggatattattgaagatgca
tacgggatcaaccttaggcctctgttaaatcttgcggaaaaatactatgacagcaacccg
aaatttatgccgaagagtgattccggtgaaccgctctctgagcatgagcgaaaccagatc
tcaaaaatccagcaggccatcgccatgattcagttcaaactcgaaatgccgatcatcaag
cgacgtcccaattttaatatgtcagagcggcttttactcgaaaaaatcgattacgacaag
atggagatcaccatctacgggaaaacgtatccccttgaacacacctgctttgccacagtg
aatccggcacagcctgatcagctgcttgaagaagaacagaaagtcatcgacaagctgttg
ttttccgttcagcattcggagaagctcgctaggcacatgaattttctcatgaaatcaggc
aatctctatttaagatacaacggcaacttattaatccacggctgtattccattggatgaa
tcgggcaacatggagaatatggacattgatggagaaacctattcaggccgcgacttgctg
gacgtatttgaacgctacttgcgtatagcctatgccaatccgcaggaaacggatgatctg
gcgacagacatggtctggtatctatggacgggggaatattcctccctgtttggaaaacgg
gaaatgactaccttcgaacggtatttcatcagcgacaaagaagcccacacggagcgaaag
aacccgtactactatttacgggaaaaagaagaaacatgcagaaaaatcctggaggaattt
gacctcaatccggatcagggacatatcgtcaacggccacacgcccgtgaaagaacggagc
ggggaaagtcctgtgaaggcaaatggaaagatgatcgtcatcgatggcggcttctccaag
gcttatcagtcagataccgggatcgccggctacaccttgctgtacaattcctacgggatg
caactcgtggcccataaacattttcattcaaaagaagatgttctccaaaacggaactgat
gtattatccgtcaaacggctggtcgataaggaacttgtgcgaaaaaaggtccgggaaacc
aatgtcggaaaagaactgttgcaggaagtggccatcttaaagagtttgatgtcgtaccgc
tatatgagctga

DBGET integrated database retrieval system