KEGG   Bacillus selenitireducens: Bsel_3051Help
Entry
Bsel_3051         CDS       T01243                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bse  Bacillus selenitireducens
Pathway
bse00040  Pentose and glucuronate interconversions
bse00052  Galactose metabolism
bse00500  Starch and sucrose metabolism
bse00520  Amino sugar and nucleotide sugar metabolism
bse01100  Metabolic pathways
bse01130  Biosynthesis of antibiotics
Module
bse_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bsel_3051
   00052 Galactose metabolism
    Bsel_3051
   00500 Starch and sucrose metabolism
    Bsel_3051
   00520 Amino sugar and nucleotide sugar metabolism
    Bsel_3051
Enzymes [BR:bse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bsel_3051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Smr CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADI00533
JGI: Bsel_3051
UniProt: D6Y031
Position
complement(3283539..3284423)
Genome map
AA seq 294 aa AA seqDB search
MKQVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKG
KRAIEDHFDHAFELEENLKEKGKDELLEKVQHSSNMVDIHYIRQKEALGLGHAIWCARKF
IGDEPFAVLLGDDIVQSDEPCLKQLIDRYNTRGASVVGVQQVPDAETKRYGIVDPEQQME
ERLYSVSHLVEKPKEGTAPSNLAIMGRYVLTPEIFEFLGEKERGAGNEIQLTDAIEKLNT
IQRVFAYDFEGRRFDVGEKIGFVKTTVELAMQDPEIERELKPFLEELLGLVKEQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcaagtaaaaaaagcgattattccggcggcgggtcttggaacccgctttttgcct
gcgacaaaggcgatgccaaaagagatgctgccgatcgtcgataaaccgacgattcagtac
atcgtcgaagaggcggtggcatcaggaattgaagacattatcatcgtcacgggaaaaggg
aagcgggcgattgaagatcacttcgatcacgcctttgaactcgaagagaacttaaaggag
aagggaaaagatgagctccttgagaaggtgcaacactcttcaaatatggtcgacattcat
tacatccgccaaaaggaagcccttggactcggtcatgcgatctggtgcgcgaggaagttc
attggcgatgaaccgtttgccgtactcttgggggacgatattgttcagtcggatgagcct
tgtttaaagcagctcatcgaccggtacaatacccggggtgcttccgtcgtcggtgtccag
caggtacctgatgcggaaacgaagcgttacgggatcgtcgatcccgaacagcaaatggaa
gaacggctgtacagcgtcagtcacctggtggagaagccaaaagaaggcacagcgccttcg
aacctcgcaatcatgggccgctatgtcctgacgccggagatctttgaatttcttggggaa
aaagagcggggagccgggaacgagatccagctaaccgacgcgatcgagaagctgaatacg
attcagcgcgtctttgcctacgactttgaaggcagacgcttcgacgtcggggagaagatc
ggatttgtaaaaacaaccgtagagcttgccatgcaggatcctgaaattgaacgcgagttg
aaaccgttccttgaagagttgcttgggcttgttaaagaacagtga

DBGET integrated database retrieval system