KEGG   Bacillus selenitireducens: Bsel_3176Help
Entry
Bsel_3176         CDS       T01243                                 

Definition
Thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bse  Bacillus selenitireducens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bsel_3176
Enzymes [BR:bse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Bsel_3176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3426269..3426898)
Genome map
AA seq 209 aa AA seqDB search
MHLTRKEGWLEVICGSMFSGKSEELIRRVRRAHYGRQKVQVFKPAIDNRYSDEEVVSHSG
NKVTAVPVGASEDVIELIHSSTQVVAFDEVQFFDEHIVALAEKLADDGIRVIVAGLDQDF
RGEPFGVVPQLMSMAESVTKLQAICLSCGSPASRTQRLIDGRPASFDDPIILVGASESYE
PRCRHCHEVPNKPRNHRFENVGYSSKPLF
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaacaagaaaagaaggctggcttgaagtcatatgcggcagcatgttttccggt
aaatcagaggagctgatccgccgggtgcgccgcgctcactacggacgccagaaagtccag
gtctttaaaccggcgatcgataaccgttactccgacgaggaagtcgtctcacacagcggc
aataaagtgacagctgtcccagtcggtgcttctgaagacgtcattgaactcattcacagc
agtacacaggtggtcgcatttgacgaagtgcagttttttgatgaacatatcgtagccttg
gctgagaagctggctgatgacgggatccgcgtgatcgtcgcaggactcgaccaggatttt
cgcggcgaaccgttcggcgtcgtgccgcagctgatgtccatggccgagtcggtgacaaaa
ctgcaggcgatttgcctctcatgcggatcaccggcgagccgcacacaacgcctgattgat
gggcggccggcatcctttgatgatccgattattctcgtcggtgcatctgaatcgtatgaa
ccgcgatgtcgtcactgccacgaagtacccaataaaccgcgtaatcaccgctttgagaac
gttggttactcctcaaaacctctattttga

DBGET integrated database retrieval system