KEGG   Bacillus selenitireducens: Bsel_3262Help
Entry
Bsel_3262         CDS       T01243                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bse  Bacillus selenitireducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bsel_3262
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bsel_3262
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bsel_3262
Enzymes [BR:bse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bsel_3262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3523735..3524796
Genome map
AA seq 353 aa AA seqDB search
MMWRGLLEEYKPYLPVNDRTPMLSLQEGNTPLLPLCHLSEKYGVELYVKYDGANPTGSFK
DRGMVMAVAKAKEAGSEAIMCASTGNTSAAAAAYAAQAKMRCFIVIPDGKIAMGKLAQAV
VYGAEIVSIEGNFDHALQMVRNLEHQSPITLVNSVNPYRIEGQKTAAFEVIDALGSEPDI
LSIPVGNAGNITAYWKGFKEYHEAKGTGLPQMRGFEAEGSASIAMNKVIDNPETLATAIR
IGNPASWKQAVNAAEESGGKIDYVTDEEIVEAYKLLAREEGVFAEPASAASVAGLIKQLK
SGEIKKGSKVVCVLTGNGLKDPNTAIDTAPVQPTALPNDEKVVFEHLLGRVNA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcgaggattacttgaggaatataaaccgtatttacccgtgaacgaccgaaca
ccaatgctgtctttgcaggaagggaacacgccgctgttgccactgtgtcacctgtcagaa
aaatatggtgtggagctttatgtgaaatacgacggcgcgaacccgaccggttcatttaaa
gaccgcggcatggttatggctgtggccaaagcgaaagaggcaggaagcgaagcaatcatg
tgtgcgtcaacggggaacacatccgccgccgccgcggcctatgcggcccaggcgaagatg
cgctgcttcatcgtcatccctgacggcaagattgccatgggaaaactcgcccaggccgtc
gtctacggtgctgaaatcgtcagtatcgaagggaactttgaccacgccctgcagatggta
cgaaaccttgagcaccagtcgccgatcaccctcgtgaactccgtgaatccgtaccggatc
gaagggcagaaaaccgctgcctttgaagtaatcgatgcccttggctcagaaccggacatc
ctctcgattcccgttggcaatgccggaaatatcaccgcgtactggaaaggcttcaaagaa
taccacgaagcgaaaggaacgggccttccccagatgcgcggctttgaagcagaagggtca
gcttcgattgccatgaacaaggtgatcgacaacccggaaacgcttgctactgcaattcgg
atcggaaacccggcaagctggaaacaggccgtcaacgccgcagaggaatccggtggaaaa
attgattatgtaacagacgaagaaatcgtagaggcatacaaactcctcgcccgagaagaa
ggcgtctttgcagaacctgcttccgccgcgtctgtcgcaggactcatcaagcagctcaaa
tccggagagatcaaaaaaggatcgaaggttgtctgcgtcctgaccggaaacggactgaaa
gatcctaacacggccatcgacacagcgccggtccagccaacggcccttccgaatgatgag
aaagtcgtttttgagcacttactgggacgtgtgaacgcatga

DBGET integrated database retrieval system