KEGG   Bacillus subtilis subsp. subtilis 6051-HGW: BSU6051_03280Help
Entry
BSU6051_03280     CDS       T02503                                 

Gene name
nasF
Definition
uroporphyrin-III C-methyltransferase NasF (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bsh  Bacillus subtilis subsp. subtilis 6051-HGW
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bsh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(353900..355351)
Genome map
AA seq 483 aa AA seqDB search
MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKLLEFASPDCQFIYCGK
LPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEADALHEHGIRYEMVPGI
TSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEGLARSVQTLVFYMGVKNL
SYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQKVQEHQITNPAIIVIGDIV
NFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADLIEWPKWRTENMPVNEEILR
KIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAASEQAKTELEKRGFLVTAIQP
DSEKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTHMIQRTISESPLHMVICPNKLS
VQQLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGFTAVQEQDELLAFIHNQHAEKKL
LHT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaagaacggaatcgtatatttcgtgggagccggacccggcgacccaggcctg
ctcaccatcaaaggaaaacaggcgctcaaggaagcagatgtgattttatatgaccggctc
gccaacccgaagctgctcgaatttgcatcaccggactgccagtttatttattgcggaaaa
ctgccaaaccgccattttatgaaacaaaaagaaattaacgccctgctggttgaaaaagca
ttaaatgggttaaccgtcgttcgcttgaagggcggagatccgagcgtattcggcagagtc
ggcgaggaagcagatgctcttcatgagcacggcattcgctatgaaatggtgccgggaatc
acctctggaattgcagcgccgctatatgcgggcatccccgtcacgcatcgggattttgca
tcgtcttttgccatgattacagcgcatgataaatcattaaaaggcacgccgaaccttgac
tgggaagggctggcccgaagcgttcaaacccttgttttttacatgggtgtcaagaacttg
tcttatatttgccagcagcttatttcatacgggaaatcgccttctgtccctgtcattgtc
atccaatggggaacgtggggccgccagcggagtgtgaaaggaacacttgagaacattcag
caaaaagtgcaggaacaccagattacaaaccctgcgattatcgtcatcggagacatcgtc
aactttcaaacacacagctggtttgaaagcaaaccgctcatcggacggcatttgatggtt
gtgactcatggcgaagatgaagacccgcttgcagacaagctgcgcgattccggcgccgat
ctcatcgagtggccgaaatggcggaccgaaaacatgcctgtcaatgaagaaattcttcga
aagattggcacctttgaagacgtttttttcacatcgcgccgggcggtttgtgaatttttc
agagcactggcttctcagaaaatcgacatccgccagctgacagccaaactgagtgcagca
tctgagcaagcaaagacagagcttgagaaacggggctttcttgtcaccgccattcagcct
gattcagagaaacgtcttgttgtcgggagccgccatgcagtggaaaacatgcaaaagcat
gaatcctgttcgttttatatcactcatgaaaacgtcatagatgaccggttcacccacatg
attcagcgtaccatcagtgaatccccgctgcacatggtcatttgcccaaacaagctgtcc
gttcagcaattgatcaatggtggcgaacaaattggcattttgccggaaccgtcagcaagc
cgccctcctatcgtctgcataggcgatgactcagctgccggcatttatggattcacagcc
gtacaagaacaggatgaattgctagctttcatccacaatcaacatgcagagaaaaaactc
cttcacacctga

DBGET integrated database retrieval system